1 / 26

Protein Structure Modeling: A Comprehensive Guide | Fold Recognition, Homology, Comparative Modeling

Learn about protein structure modeling techniques including fold recognition, homology modeling, and comparative modeling. Understand the principles and methods used in predicting protein structures. Get insights into template selection, sequence alignment, and structure evaluation. Explore the evolution of protein structure families and their relevance in drug design and biochemistry. Enhance your skills in structural modeling with the step-by-step process outlined by Alejandro Giorgetti.

nhu
Télécharger la présentation

Protein Structure Modeling: A Comprehensive Guide | Fold Recognition, Homology, Comparative Modeling

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. 3rd Permanent School in Bioinformatics Madrid 2005 Protein Structure Modeling Alejandro Giorgetti Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  2. Public Database Holdings: The number of different protein folds is limited: Known Folds [ last update: Oct 2001 ] NewFolds Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  3. Fold recognition Q M T S A F G T A E Profile methods • Fold =f(environment) • Local Secondary Structure • Solvent Accessibility • Degree of burial of polar / apolar Principle: Find a compatible fold >Target Sequence XY MSTLYEKLGGTTAVDLAVAAVAGAPAHKRDVLNQ Threading Fragment based methods: New fold prediction Build model of target protein based on each template structure Rank models according to SCORE or ENERGY Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  4. Some remarks concerning fold recognition: • Capable of detecting quite remote sequence-structure matches. • Sensitivity depends on the size of the protein and its secondary structure content. • The two most versatile enzymatic functions (hydrolases and o-glycosyl- glucosidases) are associated with seven folds each. • Better for detecting: all-α > αβ > all-β Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  5. Homology modeling • Comparative protein modeling Idea:Proteins evolving from a common ancestor maintained similar core 3D structures. • Known structure/s is/are used as a template to model an unknown structure with known sequence. • Both of them should be related by evolution. • First applied in late 1970’s by Tom Blundell Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  6. Evolution of protein structure families 90 % Drug design? 70 % Biochemistry? X-ray cristallography: MR 50 % 30 % Molecular Biology? 10 % [ Chothia & Lesk (1986) ] Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  7. Comparative Modeling Known Structures (templates) Template(s) selection Target sequence Sequence Alignment Structure Evaluation >hTEII MSSPQAPEDGQGCGDRGDPPGDLRSVLVTTV LNLEPLDEDLFRGRHYWVPAKRLFGGQIVGQ ALVAAAKSVSEDVHVHSLHCYFVRAGDPKLP Structure Modeling Final Structural Models Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  8. Comparative Modeling Known Structures (templates) Template(s) selection Target sequence • Protein Data Bank PDB http://www.pdb.org • Database of templates • Separate into single chains • Remove bad structures (models) • Create BLAST database Sequence Alignment Structure Evaluation Structure Modeling Final Structural Models Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  9. Comparative Modeling Known Structures (templates) Template(s) selection Target sequence • Sequence Similarity / Fold recognition • Structure quality (resolution, experimental method) • Experimental conditions (ligands and cofactors) Sequence Alignment Structure Evaluation Structure Modeling Final Structural Models Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  10. Comparative Modeling Known Structures (templates) Template(s) selection Target sequence • Key step in homology modeling • Global alignment is required • Small error in alignment can lead to big error in model • Multiple alignments are better than pairwise alignments • Do we know something else? Experiments? Sequence Alignment Structure Evaluation Structure Modeling Final Structural Models Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  11. Comparative Modeling Known Structures (templates) Template(s) selection Target sequence Sequence Alignment Structure Evaluation • Template based fragment Assembly (SwissMod). • Satisfaction of Spatial Restraints: MODELLER Structure Modeling Final Structural Models Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  12. Comparative Modeling Known Structures (templates) Template(s) selection Target sequence • Errors in template selection or alignment result in bad models • Iterative cycles of alignment, modeling and evaluation Sequence Alignment Structure Evaluation Structure Modeling Final Structural Models Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  13. I. Template based fragment assembly (SwissModel) [ http://www.expasy.org/spdbv/ ] Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  14. Day activities. Morning • SwissPdb downloading: • Read and Accept licence • Download: SwissPdb viewer v3.7sp5(linux) • Installation: • gunzip spdbv37sp5-Linux.tar.gz • tar –xvf spdbv37sp5-Linux.tar • cd SPDBV_Distribution and do: ./install.sh • Local installation : ..../guestxx/ • Run: /guestxx/SPDBV/bin/spdbv • SwissModel submission: • Search template: http://www.expasy.org/swissmod/SWISS-MODEL.html Interactive tools: Search the template...(paste sequence) • Model request submission: Save project (SwissPdb Viewer); • Swiss- Model web page: Modelling Requests – Optimise mode. • Fill the form and Upload your project asking for Short mode output. Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  15. I. Template based fragment assembly a) Build conserved core framework (Structurally conserved regions -SCRs) [ http://www.expasy.org/spdbv/ ] • Corresponds to the most stable regions. • Highest sequence conservation and fewer gaps. • In general: secondary structures elements. Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  16. I. Template based fragment assembly b) Loop modeling (Structural variable regions - SVRs) and backbone completion • Least stable or more flexible regions. • Highest level of gapping • Lowest sequence conservation • Loops and turns • Loop-Database • “ab-initio” rebuilding of loops (Monte Carlo, molecular dynamics, genetic algorithms, etc.) [ http://www.expasy.org/spdbv/ ] Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  17. I. Template based fragment assembly c) Side Chain placement • Find the most probable side chain conformation, using • homologues structures • back-bone dependent rotamer libraries • energetic and packing criteria [ http://www.expasy.org/spdbv/ ] Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  18. I. Template based fragment assembly d) Energy minimization • modeling will produce unfavorable contacts and bonds •  idealization of local bond and angle geometry • extensive energy minimization will move coordinates away •  keep it to a minimum • SwissModel is using GROMOS 96 force field Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  19. II. Modeling by Satisfaction of Spatial restraints • Find the most probable structure given its alignment • Satisfy spatial restraints derived from the alignment. • Uses probability density functions. • Minimizes violations on restraints. Comparative protein modeling by satisfaction of spatial restraints. A. Šali and T.L. Blundell. J. Mol. Biol. 234, 779-815 Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  20. Model Evaluation ? • Topics: • correct fold • model coverage (%) • C - deviation (rmsd) • alignment accuracy (%) • side chain placement • Structure Analysis and Verification Server: http://nihserver.mbi.ucla.edu/SAVS/ Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  21. EVA Evaluation of Automatic protein structure prediction [ Burkhard Rost, Andrej Sali, http://maple.bioc.columbia.edu/eva ] Model Accuracy Evaluation CASP Community Wide Experiment on the Critical Assessment of Techniques for Protein Structure Prediction http://PredictionCenter.llnl.gov/casp6 3D - Crunch Very Large Scale Protein Modelling Project http://www.expasy.org/swissmod/SM_LikelyPrecision.html Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  22. Protein Structure Resources PDB http://www.pdb.orgPDB – Protein Data Bank of experimentally solved structures (RCSB) CATH http://www.biochem.ucl.ac.uk/bsm/cath Hierarchical classification of protein domain structures SCOP http://scop.mrc-lmb.cam.ac.uk/scopAlexey Murzin’s Structural Classification of proteins DALI http://www2.ebi.ac.uk/daliLisa Holm and Chris Sander’s protein structure comparison server SS-Prediction and Fold Recognition PHD http://cubic.bioc.columbia.edu/predictprotein Burkhard Rost’s Secondary Structure and Solvent Accessibility Prediction Server PSIPRED http://bioinf.cs.ucl.ac.uk/psipred/ L.J McGuffin, K Bryson & David T. Jones Secndary struture prediction Server 3DPSSM http://www.sbg.bio.ic.ac.uk/~3dpssFold Recognition Server using 1D and 3D Sequence Profiles coupled. THREADER: http://bioinf.cs.ucl.ac.uk/threader/threader.html David T. Jones threading program Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  23. Protein Structure Classification CATH - Protein Structure Classification [ http://www.biochem.ucl.ac.uk/bsm/cath_new/ ] • UCL, Janet Thornton & Christine Orengo • Class (C), Architecture(A), Topology(T), Homologous superfamily (H) SCOP - Structural Classification of Proteins • MRC Cambridge (UK), Alexey Murzin, Brenner S. E., Hubbard T., Chothia C. • created by manual inspection • comprehensive description of the structural and evolutionary relationships [ http://scop.mrc-lmb.cam.ac.uk/scop/ ] Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  24. Class(C)derived from secondary structure content is assigned automatically • Architecture(A)describes the gross orientation of secondary structures, independent of connectivity. • Topology(T) clusters structures according to their topological connections and numbers of secondary structures • Homologous superfamily (H) Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  25. Protein Homology Modeling Resources SWISS MODEL: http://www.expasy.org/swissmod/SWISS-MODEL.html Deep View - SPDBV: homepage: http://www.expasy.ch/spdbv Tutorials http://www.expasy.org/spdbv/text/tutorial.htm WhatIf http://www.cmbi.kun.nl:1100/ Gert Vriend’s protein structure modeling analysis program WhatIf Modeller: http://guitar.rockefeller.edu/modeller Andrej Sali's homology protein structure modelling by satisfaction of spatial restraints ROBETTA: http://robetta.bakerlab.org/ Full-chain Protein Structure Prediction Server Programs and www servers very useful in Comparative modeling: http://salilab.org/tools/ Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

  26. Alejandro Giorgetti alejandro.giorgetti@uniroma1.it

More Related