ordell
Uploaded by
57 SLIDES
1374 VUES
630LIKES

Databases in Bioinformatics

DESCRIPTION

Databases in Bioinformatics. From a ppt by Mark Pallen Prof. Of Bacterial pathogenesis Univ. Birmingham. Databases in Bioinformatics. Sequence databases Sequence analysis Functional genomics Literature databases Structural databases Metabolic pathway databases

1 / 57

Download Presentation
Télécharger la présentation

Databases in Bioinformatics

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Databases in Bioinformatics From a ppt by Mark Pallen Prof. Of Bacterial pathogenesis Univ. Birmingham

  2. Databases in Bioinformatics • Sequence databases • Sequence analysis • Functional genomics • Literature databases • Structural databases • Metabolic pathway databases • Specialised databases

  3. The definitive source…. http://nar.oxfordjournals.org/content/vol34/suppl_1/index.dtl

  4. DNA Sequence databases • Main repositories: • GenBank (US) • (http://www.ncbi.nlm.nih.gov/Genbank/index.html) • EMBL (Europe) • (http://www.ebi.ac.uk/embl/) • DDBJ (Japan) • (http://www.ddbj.nig.ac.jp/) • Primary databases • DNA sequences are identical

  5. www.ncbi.nlm.nih.gov

  6. PubMed is… • National Library of Medicine's search service • >14 million citations in MEDLINE • links to participating online journals • PubMed tutorial (via side bar)

  7. ENTREZ THE LIFE SCIENCES ENGINE • Entrez integrates… • the scientific literature; • DNA and protein sequence databases; • 3D protein structure data; • population study data sets; • assemblies of complete genomes

  8. Entrez is a search and retrieval system that integrates NCBI databases

  9. OMIM is… • Online Mendelian Inheritance in Man • catalog of human genes and genetic disorders • edited by Dr. Victor McKusick, others at JHU …John Hopkins University

  10. Taxonomy Browser is… • browser for the major divisions of living organisms • (archaea, bacteria, eukaryota, viruses) • taxonomy information such as genetic codes • molecular data on extinct organisms

  11. Structure site includes… • Molecular Modelling Database (MMDB) • biopolymer structures obtained from • the Protein Data Bank (PDB) • Cn3D (a 3D-structure viewer) • vector alignment search tool (VAST) http://www.ncbi.nlm.nih.gov/Structure/VAST/vast.shtml

  12. How can I use PubMed at NCBI to find literature information?

  13. PubMed is the NCBI gateway to MEDLINE. MEDLINE contains bibliographic citations and author abstracts from over 4,000 journals published in the United States and in 70 foreign countries. It has 12 million records dating back to 1966.

  14. MeSH is the acronym for "Medical Subject Headings." MeSH is the list of the vocabulary terms used for subject analysis of biomedical literature at NLM. MeSH vocabulary is used for indexing journal articles for MEDLINE. The MeSH controlled vocabulary imposes uniformity and consistency to the indexing of biomedical literature.

  15. PubMed search strategies • Try the tutorial on the left sidebar • Use boolean queries • lipocalin AND disease • Try using “limits” • Try “LinkOut” to find external resources

  16. 1 AND 2 1 2 lipocalin AND disease (96 results) 1 OR 2 1 2 lipocalin OR disease (1.9 million results) 1 NOT 2 1 2 lipocalin NOT disease (729 results)

  17. Fulltext Literature Databases • Highwire • Google Scholar • Google Print • Useful for finding information about genes buried in tables in papers, invisible to PubMed

  18. From Highwire ...Stanford University

  19. What is an accession number? An accession number is label that used to identify a sequence. It is a string of letters and/or numbers that corresponds to a molecular sequence. Examples (all for retinol-binding protein, RBP4): X02775 GenBank genomic DNA sequence NT_030059 Genomic contig Rs7079946 dbSNP (single nucleotide polymorphism) N91759.1 An expressed sequence tag (1 of 170) NM_006744 RefSeq DNA sequence (from a transcript) NP_007635 RefSeq protein AAC02945 GenBank protein Q28369 SwissProt protein 1KT7 Protein Data Bank structure record DNA RNA protein

  20. How can I use NCBI (or other sites) to find information about a protein or gene?

  21. FASTA format

  22. Graphics format

  23. Question #4: How can I find information about a particular disease? Answer: Try OMIM

  24. Sequence Databases • Annotated sequence databases • SWISS-PROT, GenBank etc… • Usage: identifying function, retrieving information • Low-annotation sequence databases • EST databases, high-throughput genome sequences • Usage: discovery of new genes

  25. General Protein Databases • SWISS-PROT • Manually curated • high-quality annotations, less data • GenPept/TREMBL • Translated coding sequences from GenBank/EMBL • Few annotations, more up to date • PIR • Phylogenetic-based annotations • All 3 now combining efforts to form UniProt (http://www.uniprot.org)

  26. Low-annotation Databases • ESTs (Expressed Sequence Tags) • Low quality sequences generated by high -volume sequencing the 3’ or 5’ end of cDNAs • http://www-users.med.cornell.edu/~jawagne/cDNA_cloning.html • High-throughput genome sequences • Produced by mass-sequencing of genomic DNA

  27. Non-redundant Databases • Sequence data only: cannot be browsed, can only be searched using a sequence • Combine sequences from more than one database • Examples: • NR Nucleic (genbank+EMBL+DDBJ+PDB DNA) • NR Protein (SWISS-PROT+TrEMBL+GenPept+PDB protein)

  28. Sequence & Structure Databases • PDB (Protein Databank) • Stores 3-dimensional atomic coordinates for biological molecules including protein and nucleic acids • Data obtained by X-ray crystallography, NMR, or computer modeling • http://www.rcsb.org/pdb/ • MMDB (Molecular Modeling database) • Over 28,000 3D macromolecular structures, including proteins and polynucleotides • (http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=Structure) • SCOP (Structural Classification of Proteins) • Classification of proteins according to structural and evolutionary relationships

  29. File Formats • GenBank/GB, genbank flatfile format • NBRF format • EMBL, EMBL flatfile format • Swissprot • GCG, single sequence format of GCG software • DNAStrider, for common Mac program • Pearson/Fasta, a common format used by Fasta programs and others • Phylip3.2, sequential format for Phylip programs • Phylip, interleaved format for Phylip programs (v3.3, v3.4) • Plain/Raw, sequence data only (no name, document, numbering) • MSF multi sequence format used by GCG software • PAUP"s multiple sequence (NEXUS) format • ASN.1 format used by NCBI

  30. EMBL Format ID TRBG361 standard; mRNA; PLN; 1859 BP.XXAC X56734; S46826;XXSV X56734.1XXDT 12-SEP-1991 (Rel. 29, Created)DT 15-MAR-1999 (Rel. 59, Last updated, Version 9)XXDE Trifolium repens mRNA for non-cyanogenic beta-glucosidaseXXKW beta-glucosidase.XXOS Trifolium repens (white clover)OC Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;OC Spermatophyta; Magnoliophyta; eudicotyledons; core eudicots; rosids;OC eurosids I; Fabales; Fabaceae; Papilionoideae; Trifolieae; Trifolium.XXRN [5]RP 1-1859RX MEDLINE; 91322517.RX PUBMED; 1907511.RA Oxtoby E., Dunn M.A., Pancoro A., Hughes M.A.;RT "Nucleotide and derived amino acid sequence of the cyanogenicRT beta-glucosidase (linamarase) from white clover (Trifolium repens L.).";RL Plant Mol. Biol. 17(2):209-219(1991).XXRN [6]RP 1-1859RA Hughes M.A.;RT ;RL Submitted (19-NOV-1990) to the EMBL/GenBank/DDBJ databases.RL M.A. Hughes, UNIVERSITY OF NEWCASTLE UPON TYNE, MEDICAL SCHOOL, NEW CASTLERL UPON TYNE, NE2 4HH, UKXXDR GOA; P26204.DR MENDEL; 11000; Trirp;1162;11000.DR SWISS-PROT; P26204; BGLS_TRIRP.XX FH Key Location/QualifiersFHFT source 1..1859FT /db_xref="taxon:3899"FT /mol_type="mRNA"FT /organism="Trifolium repens"FT /tissue_type="leaves"FT /clone_lib="lambda gt10"FT /clone="TRE361"FT CDS 14..1495FT /db_xref="GOA:P26204"FT /db_xref="SWISS-PROT:P26204"FT /note="non-cyanogenic"FT /EC_number="3.2.1.21"FT /product="beta-glucosidase"FT /protein_id="CAA40058.1"FT /translation="MDFIVAIFALFVISSFTITSTNAVEASTLLDIGNLSRSSFPRGFIFT FGAGSSAYQFEGAVNEGGRGPSIWDTFTHKYPEKIRDGSNADITVDQYHRYKEDVGIMKFT DQNMDSYRFSISWPRILPKGKLSGGINHEGIKYYNNLINELLANGIQPFVTLFHWDLPQFT VLEDEYGGFLNSGVINDFRDYTDLCFKEFGDRVRYWSTLNEPWVFSNSGYALGTNAPGRFT CSASNVAKPGDSGTGPYIVTHNQILAHAEAVHVYKTKYQAYQKGKIGITLVSNWLMPLDFT DNSIPDIKAAERSLDFQFGLFMEQLTTGDYSKSMRRIVKNRLPKFSKFESSLVNGSFDFFT IGINYYSSSYISNAPSHGNAKPSYSTNPMTNISFEKHGIPLGPRAASIWIYVYPYMFIQFT EDFEIFCYILKINITILQFSITENGMNEFNDATLPVEEALLNTYRIDYYYRHLYYIRSAFT IRAGSNVKGFYAWSFLDCNEWFAGFTVRFGLNFVD"FT mRNA 1..1859FT /evidence=EXPERIMENTALXXSQ Sequence 1859 BP; 609 A; 314 C; 355 G; 581 T; 0 other;aaacaaacca aatatggatt ttattgtagc catatttgct ctgtttgtta ttagctcatt 60cacaattact tccacaaatg cagttgaagc ttctactctt cttgacatag gtaacctgag 120tcggagcagt tttcctcgtg gcttcatctt tggtgctgga tcttcagcat accaatttga 180aggtgcagta aacgaaggcg gtagaggacc aagtatttgg gataccttca cccataaata 240tccagaaaaa ataagggatg gaagcaatgc agacatcacg gttgaccaat atcaccgcta 300caaggaagat gttgggatta tgaaggatca aaatatggat tcgtatagat tctcaatctc 360ttggccaaga atactcccaa agggaaagtt gagcggaggc ataaatcacg aaggaa http://www.ebi.ac.uk/embl/Documentation/User_manual/usrman.html

  31. Genbank Format LOCUS SCU49845 5028 bp DNA PLN 21-JUN-1999 DEFINITION Saccharomyces cerevisiae TCP1-beta gene, partial cds, and Axl2p (AXL2) and Rev7p (REV7) genes, complete cds. ACCESSION U49845 VERSION U49845.1 GI:1293613 KEYWORDS . SOURCE Saccharomyces cerevisiae (baker's yeast) ORGANISM Saccharomyces cerevisiae Eukaryota; Fungi; Ascomycota; Saccharomycotina; Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Saccharomyces. REFERENCE 1 (bases 1 to 5028) AUTHORS Torpey,L.E., Gibbs,P.E., Nelson,J. and Lawrence,C.W. TITLE Cloning and sequence of REV7, a gene whose function is required for DNA damage-induced mutagenesis in Saccharomyces cerevisiae JOURNAL Yeast 10 (11), 1503-1509 (1994) MEDLINE 95176709 PUBMED 7871890 REFERENCE 2 (bases 1 to 5028) AUTHORS Roemer,T., Madden,K., Chang,J. and Snyder,M. TITLE Selection of axial growth sites in yeast requires Axl2p, a novel plasma membrane glycoprotein JOURNAL Genes Dev. 10 (7), 777-793 (1996) MEDLINE 96194260 PUBMED 8846915 REFERENCE 3 (bases 1 to 5028) AUTHORS Roemer,T. TITLE Direct Submission JOURNAL Submitted (22-FEB-1996) Terry Roemer, Biology, Yale University, New Haven, CT, USA FEATURES Location/Qualifiers source 1..5028 /organism="Saccharomyces cerevisiae" /db_xref="taxon:4932" /chromosome="IX" gene 687..3158 /gene="AXL2" CDS 687..3158 /gene="AXL2" /note="plasma membrane glycoprotein" /codon_start=1 /function="required for axial budding pattern of S. cerevisiae" /product="Axl2p" /protein_id="AAA98666.1" /db_xref="GI:1293615" /translation="MTQLQISLLLTATISLLHLVVATPYEAYPIGKQYPPVARVNESF TFQISNDTYKSSVDKTAQITYNCFDLPSWLSFDSSSRTFSGEPSSDLLSDANTTLYFN VILEGTDSADSTSLNNTYQFVVTNRPSISLSSDFNLLALLKNYGYTNGKNALKLDPNE VFNVTFDRSMFTNEESIVSYYGRSQLYNAPLPNWLFFDSGELKFTGTAPVINSAIAPE TSYSFVIIATDIEGFSAVEVEFELVIGAHQLTTSIQNSLIINVTDTGNVSYDLPLNYV YLDDDPISSDKLGSINLLDAPDWVALDNATISGSVPDELLGKNSNPANFSVSIYDTYG DVIYFNFEVVSTTDLFAISSLPNINATRGEWFSYYFLPSQFTDYVNTNVSLEFTNSSQ DHDWVKFQSSNLTLAGEVPKNFDKLSLGLKANQGSQSQELYFNIIGMDSKITHSNHSA NATSTRSSHHSTSTSSYTSSTYTAKISSTSAAATSSAPAALPAANKTSSHNKKAVAIA CGVAIPLGVILVALICFLIFWRRRRENPDDENLPHAISGPDLNNPANKPNQENATPLN NPFDDDASSYDDTSIARRLAALNTLKLDNHSATESDISSVDEKRDSLSGMNTYNDQFQ SQSKEELLAKPPVQPPESPFFDPQNRSSSVYMDSEPAVNKSWRYTGNLSPVSDIVRDS YGSQKTVDTEKLFDLEAPEKEKRTSRDVTMSSLDPWNSNISPSPVRKSVTPSPYNVTK HRNRHLQNIQDSQSGKNGITPTTMSTSSSDDFVPVKDGENFCWVHSMEPDRRPSKKRL VDFSNKSNVNVGQVKDIHGRIPEML BASE COUNT 1510 a 1074 c 835 g 1609 t ORIGIN 1 gatcctccat atacaacggt atctccacct caggtttaga tctcaacaac ggaaccattg 61 ccgacatgag acagttaggt atcgtcgaga gttacaagct aaaacgagca gtagtcagct 121 ctgcatctga agccgctgaa gttctactaa gggtggataa catcatccgt gcaagaccaa 181 gaaccgccaa tagacaacat atgtaacata tttaggatat acctcgaaaa taataaaccg 241 http://www.ncbi.nlm.nih.gov/Sitemap/samplerecord.html

  32. Swissprot format http://us.expasy.org/sprot/userman.html

  33. Specialized Sequence Databases • Focus on a specific type of sequences • Sequences are often modified or specially annotated • Usage depends on the database • Examples: • Ribosomal RNA databases • Immunology databases

  34. Protein domain databases • Pfam (http://www.sanger.ac.uk/Software/Pfam/) Collection of multiple sequence alignments and hidden Markov models covering many common protein domains and families • SMART (a Simple Modular Architecture Research Tool) Identification and annotation of genetically mobile domains and the analysis of domain architectures (http://smart.embl-heidelberg.de/help/smart_about.shtml • CDD (http://www.ncbi.nlm.nih.gov/Structure/cdd/wrpsb.cgi) Combines SMART and Pfam databases Easier and quicker search

  35. Sequence Motif Databases • Scan Prosite (http://www.expassy.org/prosite) and PRINTS (http://bioinf.man.ac.uk/dbbrowser/PRINTS/) • Store conserved motifs occurring in nucleic acid or protein sequences • Motifs can be stored as consensus sequences, alignments, or using statistical representations such as residue frequency tables

  36. Ribosomal RNA Databases • RDP (Michigan State University, USA) • http://rdp.cme.msu.edu/html/ • rRNA database (University of Antwerp, Belgium) • http://rrna.uia.ac.be/ • ribosomal RNA sequences are pre-aligned according to their secondary structure • Usage: creating data sets for molecular phylogeny, especially for microbial taxonomy and identification

  37. Immunological Sequence Databases • The Kabat Database of Sequences of Proteins of Immunological Interest • www.hgmp.mrc.ac.uk/Bioinformatics/Databases/kabatp-help.html • Sequences are classified according to antigen specificity, and available in pre-aligned format • The Immunogenetics database (IMGT) • http://imgt.cnusc.fr:8104/ • Focuses on immunoglobulins, T-cell receptors and MHC genes

  38. Genome Databases • Focus on one organism or group of organisms • Examples: • Colibase (E. coli and related species) • http://colibase.bham.ac.uk/ • GDB (human) • http://www.gdb.org/ • Flybase (Drosophila) • http://flybase.bio.indiana.edu/ • WormBase (C. elegans) • http://wormbase.org • AtDB (Arabidopsis) • http://www.arabidopsis.org • SGD (S. cerevisiae) • http://genome-www.stanford.edu/Saccharomyces/

  39. Expression Databases • RNA expression • Results of microarray experiments measuring the change in specific mRNA content under certain conditions • Array Express (EBI) and Geo (NCBI) • Not user friendly • Proteome databases • 2D gel electrophoresis images representing the protein content of a cell or tissue under specific conditions • SWISS 2D PAGE at http://us.expasy.org/ch2d/

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer