Download
slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124] PowerPoint Presentation
Download Presentation
N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

111 Vues Download Presentation
Télécharger la présentation

N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Supplementary Fig. 1. Amino acid sequence and predicted domains of the expressed protein. N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124] Sequence ID: ref|YP_696189.1| Length: 337 1 MKIAVRGGHNFKAKGALGIIDETIENRKVYKALIKYLNIAGHNVIDVTPGECDINTDLYL 60 61 GVQKAKENNSELFLSIHFDKAYDKYEGPLGTGTWIYGRGGKAEIYAKRIVDNLSKGTGLK 120 121 NRGVKENSKLYELRKTSMPAVLVEVCFCEATEDVRIYREKGPDLIGKLIAEAINEKEIEE 180 181 NIKPEGQEDSLKEKFLKSTNAKAIANLDPRDNPSSIYKDLGEIYKGERIRVLPEICDKKD 240 241 YLPIIYWKDTTNIESQKVWVSAKQNYLKIDTNATVINVVTELDARYIKSQRSSKMGWVKN 300 301 GERLYVHKIESGYALGTYFASNGYKTAWFTAKYISLD 337 Tillman et al. Clostridium perfringens amidase