keiper
Uploaded by
32 SLIDES
349 VUES
320LIKES

Why Is Sequence Comparison Useful?

DESCRIPTION

Why Is Sequence Comparison Useful?. Lipman, David (NIH/NLM/NCBI). Almost 100 Trillion BLAST comparisons per quarter (10/01). 1.E+14. 9.E+13. 8.E+13. 7.E+13. 6.E+13. 5.E+13. 4.E+13. 3.E+13. 2.E+13. . 1 E+13. 0.E+00. 1998. 1999. 2000. 2001. Quarter.

1 / 32

Télécharger la présentation

Why Is Sequence Comparison Useful?

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Why Is Sequence Comparison Useful? Lipman, David (NIH/NLM/NCBI)

  2. Almost 100 Trillion BLAST comparisons per quarter (10/01) 1.E+14 9.E+13 8.E+13 7.E+13 6.E+13 5.E+13 4.E+13 3.E+13 2.E+13 . 1 E+13 0.E+00 1998 1999 2000 2001 Quarter

  3. Rapid similarity searches of nucleic acid and protein data banks.With the development of large data banks of protein and nucleic acid sequences, the need for efficient methods of searching such banks for sequences similar to a given sequence has become evident. We present an algorithm for the global comparison of sequences based on matching k-tuples of sequence elements for a fixed k. The method results in substantial reduction in the time required to search a data bank when compared with prior techniques of similarity analysis, with minimal loss in sensitivity. The algorithm has also been adapted, in a separate implementation, to produce rigorous sequence alignments. Currently, using the DEC KL-10 system, we can compare all sequences in the entire Protein Data Bank of the National Biomedical Research Foundation with a 350-residue query sequence in less than 3 min and carry out a similar analysis with a 500-base query sequence against all eukaryotic sequences in the Los Alamos Nucleic Acid Data Basein less than 2 min.

  4. Cancer Gene Meets Its MatchNY Times July 3, 1983“…a serendipitous computer search…” v-sis: 6 QGDPIPEELYKMLSGHSIRSFDDLQRLLQGDSGKEDGAELDLNMTRSHSGGELESLARGK 65 QGDPIPEELY+MLS HSIRSFDDLQRLL GD G+EDGAELDLNMTRSHSGGELESLARG+ PDGF : 10 QGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAELDLNMTRSHSGGELESLARGR 69 v-sis: 66 RSLGSLSVAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQ 125 RSLGSL++AEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQ PDGF : 70 RSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQ 129 v-sis: 126 CRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCEIVAAARAVTRSPGTSQEQR 185 CRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCE VAAAR VTRSPG SQEQR PDGF : 130 CRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVTRSPGGSQEQR 189 v-sis: 186 AKTTQSRVTIRTVRVRRPPKGKHRKCKHTHDKTALKETLGA 226 AKT Q+RVTIRTVRVRRPPKGKHRK KHTHDKTALKETLGA PDGF : 190 AKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLGA 230 V-sis and Platelet-Derived Growth Factor (PDGF)

  5. An earlier, more subtle discovery… • Viral src gene products are related to the catalytic chain of mammalian cAMP-dependent protein kinase Barker WC, Dayhoff MO. PNAS 1982 May;79(9):2836-2839 Query: 113 YAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKR---VKGRTWT---LC 166 Y+ +V +LHS +++ DLKP N+LI +Q +++DFG +++ ++GR + + Sbjct: 125 YSLDVVNGLLFLHSQSILHLDLKPANILISEQDVCKISDFGCSQKLQDLRGRQASPPHIG 184 Query: 167 GTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVR 223 GT + APEI+ + D ++ G+ +++M P ++ +P + +V+ +R Sbjct: 185 GTYTHQAPEILKGEIATPKADIYSFGITLWQMTTREVP-YSGEPQYVQYAVVAYNLR 240 • Biology not Algorithms • - compare proteins, not DNA • must detect similar amino acids not just identities

  6. How often would one find matches? In 1983, there were only a small percentage of genes from the genomes of a number of evolutionarily distant organisms (e.g. human, fly, yeast, e.coli). How many protein families would there be? Unexpected similarities should be extremely rare.

  7. Estimating number of protein families

  8. Zuckerkandl,E. (1974) Accomplissement et perspectives de la paleogenetique chimique. In: Ecole de Roscoff –1974, p. 69. Paris:CNRS. “The appearance of new structures and functions in proteins during evolution”, J. Mol. Evol. 7, 1-57 (1975). Dayhoff, M.O. (1974) Federation Proceedings 33, 2314. “The origin and evolution of protein superfamilies”, Fed.Proc. 35, 2132-2138 (1976). Earliest Estimates of Number of Protein Families - ~1000

  9. Margaret Dayhoff

  10. “It has been estimated that in humans there are approximately 50,000 proteins of functional or medical importance. … A landmark of molecular biology will occur when one member of each superfamily has been elucidated. At the present rate of 25 per year, this will take less than 15 years.” Atlas of Protein Sequence and Structure, Vol. 5, Supplement 3 (1978) pg. 10:

  11. Chothia, C. (1992). One thousand families for the molecular biologist. Nature, 357, 543-544. Hubris, the Genome Project, and Protein Families Green P, Lipman D, Hillier L, Waterson R, States,D, and Claverie JM (1993). Ancient Conserved Regions in New Gene Sequences and the Protein Databases. Science, 259, 1711-1716. ACR = similarity detected between sequences from distantly related organisms

  12. 1992: What new families do we get from the genome projects?

  13. Cumulative growth in number of proteins & number of conserved domains Green et al. 85% of ACRs Dayhoff 10% of superfamilies 6 1.2*10 100 6 1.0*10 80 5 8.0*10 Conserved Domain Families 60 Number of Proteins % Families Hit 5 6.0*10 40 5 4.0*10 Protein Sequences 5 20 2.0*10 0 0.0 1975 2000 1960 1965 1970 1980 1985 1990 1995

  14. Why so few families and why do they evolve slowly? Structural View Thermodynamics: Finkelstein, AV, “Why are the same protein folds used to perform different functions?” FEBS 325, pp. 23-28 (1993)

  15. Compare pairs of sequences from related classes of proteins Last universal common ancestor Constraints Due To Biological Function May Be More Important One gene Functional divergence • All sequences should at least share structural similarity Gene duplication • Divergence times for all sequences should be approximately the same prokaryotes eukaryotes • Sequences within a class share function but sequences between classes have differing function Degree within-class similarity > between-class similarity indicates importance of constraints due to biological function.

  16. Example from the Aminoacyl-tRNA synthetases (aaRS) (from E. Koonin & Y. Wolf) • Two unrelated classes of aaRS, each includes 10 aaRS related to each other • The last universal common ancestor (LUCA) of modern life forms already had at least 17 aaRS • The duplication leading to aaRS of different specificities must have occurred during a relatively short period of early evolution • The post-LUCA evolution of aaRS took much longer than the early phase when the specificities were established. However, the changes that occurred after the aaRS were locked in their specificities are small compared to the changes traced to the early phase

  17. Orthologs … (fromS. Bryant)

  18. Paralogs … (fromS. Bryant)

  19. Example from the Aminoacyl-tRNA Synthetases (aaRS) (from E. Koonin & Y. Wolf) Exceptions - glutamine/glutamate,asparagine/ aspartate & tryptophan/tyrosine

  20. 80,000Antequera F & Bird A, “Number of CpG islands and genes in human and mouse”, PNAS 90, 11995-11999 (1993). How many human genes? 120,000Liang F et al., “Gene Index analysis of the human genome estimates approximately 120,000 genes”, Nat. Gen., 25, 239-240 (2000) 35,000Ewing B & Green P, “Analysis of expressed sequence tags indicates 35,000 human genes”, Nat. Gen. 25, 232-234 (2000) 28,000-34,000Roest Crollius, H. et al., “Estimate of human gene number Provided by genome-wide analysis using Tetraodon nigroviridis DNA Sequence”, Nat. Gen. 25, 235-238 (2000). 41,000-45,000Das M et al., “Assessment of the Total Number of Human Transcription Units”, Genomics 77, 71-78 (2001)

  21. How many human genes with ACRs? (from S. Resenchuk, T.Tatusov, L. Wagner, A. Souverov) 12,245 characterized mRNAs from RefSeq 78% have ACR, i.e., hit outside vertebrates at E <10e-6( 9,496/12,245) 90% of these have corresponding GenomeScan predictions which also have ACR (8501/9496) 20,245 GS models for entire human genome have ACR 15,573 GS models after correction for splitting (20,245/1.3) 17,300 estimated human genes with ACRs ( ~15,573/.9)

  22. How many human genes? 17,303 estimated human genes with ACRs Now use comparative genomics… S.cerev. S. Pombe A.thal. C. Elegans D. mela. ACRs/genes 4022/6306 63% 4846/659373% 14443/2460558% 11598/20850 55% 10469/1433573% 17,303/.55 = ~31,500 Total Human Genes More complicated than that!

  23. Conservation, expression level, protein length, & exon number 23,600revised est. human genes with ACRs (~15,573/.66) 43,000 upper bound on est. total human genes (23,600/.55) 35,000 is more reasonable bound with this approach

  24. The relationship of protein conservation and sequence length • Lipman DJ, Souvorov A, Koonin EV, Panchenko AR, Tatusova TA • BMC Evol Biol. 2002 2:20

  25. 140 E-coli 120 4279 proteins 100 80 Number 60 40 20 0 0 200 400 600 800 1000 Length

  26. Archaeoglobus fulgidus 100 80 2420 proteins 60 Number 40 20 0 Length 0 200 400 600 800 1000

  27. Yeast 400 350 6305 proteins 300 250 Number 200 150 100 50 0 Length 0 200 400 600 800 1000

  28. 50 Drosophila 2390 proteins 40 30 Number 20 10 0 0 200 400 600 800 1000 Length

  29. 300 Human 250 14538 proteins 200 150 Number 100 50 0 0 200 400 600 800 1000 Length

  30. 100 80 60 40 20 0 200 E-value 1.e-3 E-coli 4279 proteins 150 A 100 Number 50 0 0 200 400 600 800 1000 Length 4279 proteins E-value 1.e-9 E-coli 140 120 B Number 0 200 400 600 800 1000 Length

  31. 1.2 1 0.8 6 0.6 4 0.4 2 0.2 0 0 10 8 Fraction Contact density 0 200 400 600 800 1000 Length

  32. Acknowledgements & all my colleagues at NCBI and NIH

More Related