Download
slide1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
KTI (KARYA TULIS ILMIAH) PowerPoint Presentation
Download Presentation
KTI (KARYA TULIS ILMIAH)

KTI (KARYA TULIS ILMIAH)

3906 Views Download Presentation
Download Presentation

KTI (KARYA TULIS ILMIAH)

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. AKADEMI KEBIDANAN (AKBID) BHAKTI KENCANA MATARAM KTI (KARYA TULIS ILMIAH) I GedeBudiharta

  2. DasarPemikiranTeoridanHipotesis LatarBelakangMasalah IdentifikasiMasalah Topik yang menarik  LayakUntukditeliti SetelahmembacalatarbelakangpembacadiharapkanmempunyaiGambaranmengenai : Konteksmasalahpenelitian : Situasi yang melatarbelakangimasalah yang perluditeliti. KepentinganPenelitian : Siapa yang mendapatkanmanfaat? Apakahmanfaattersebutcukupberartibagimasyarakatdanpeneliti? Apa yang belumdiketahui, sehinggakitainginmenelitimasalahtersebut? Apa yang perluditingkatkandanmengapa?

  3. Untukmenilailatarbelakangdigunakanbeberapapertanyaan : Apakahfakta yang disampaikandalamlatarbelakangtelahmenunjukanbahwamasalahpenelitianlayakuntukditeliti? Apakahrumusanmasalahpenelitiantidakterlaluluasdankabur? Apakahmasasalahpenelitiancukuppentinguntukditeliti? Apakahfaktadanuraiandilatarbelakangrelevandenganrumusanmasalahpenelitian? Apakahmasalahpenelitiantelahdirumuskandalambentukpernyataanataupertayaanintrogratifataumembukapeluangpenyelidikan?

  4. KriteriaMasalah Apa yang seharusnya (Das Sollen)  Apa yang terjadi (Das Sein) Masalah Perluditeliti TidakPerluditeliti - Dapatdidiselidikimelaluipengumpulandananalisis data - JelasKonteksdanpenyebabnya (tidakdiperlukan data untukmenjelaskanmasalahitu) = Hubunganantarakebiasaanmerokokdengangangguanpernafasan = Rata-rata HB ibuhamillebihRendahdariibu yang tidakhamil (kehamilanberhubungandengankadarhaemoglobin) Pemberiankonsentrat protein disamping tablet besidanasamfolatdapatmeningkatkankadarHbibuhamil

  5. Suatumasalahdapatdijadikanmasalahpenelitianjikamemenuhibeberapapersayaratan : FINER • Feasible (Layak) Dana, Waktu, Alat, Keahliandantersedianyasubjekpenelitian • Interesting  SuatuMasalahmenarikbagipeneliti • Novel  Membantahataumengkonfirmasi, menambahataumengembangkanpenemuanterdahuluataumenemukansesuatu yang baru • Etichal TidakBertentengandenganEtikaPenelitian • Relevant  Relevanbagiilmupengetahuan, kebijakankesehatandansebagaidasarbagipenelitiselanjutnya

  6. PERUMUSAN MASALAH PenulisanPerumusanMasalah yang baik : Masalahsebaiknyadirumuskandenganringkas, akuratdanmemungkinkanpenjelasanataupengujiansecaraempiris. • Rumusanmasalahdapatmempersoalkanhubunganatauperbedaan • Contoh : • Kepemimpinandankinerjaorganisasi • Perbedaan Strain vaksindankekebalan yang ditimbulkannya • Dukungansosialdan status kesehatan Rumusanmasalahdapatberbentukkalimattanyaataupernyataan • ApakahadaAdahubunganantar status kepegawaiandokterdiPuskesmasdengankinerjanya? • MendengarkanJenismusiktertentumempengaruhipersepsiatas rasa sakit

  7. Walaupunmasalah yang ditelitibersifatkompleks, rumusanmasalahharussedimikanjelassehinggatidakditafsirkansecaraberbeda-beda TUJUAN PENELITIAN Tujuanpenelitianmerupakanpernyataanpenelitimengenaihasilakhir yang akandicapaipadaakhirpenelitian. Tujuanpenelitiandinyatakandengankalimat yang jelas, spesifiktidakambigu Dapatdirumuskansebagai : Deskripsi, mengidentifikasikuathubungan, efeksuatufaktorterhadapsuatukejadian(Kesehehatan) danpenjelasan (Eplanatory) ataspermasalahanpenelitian

  8. Katakerja yang digunakandalammenyatakantujuanpenelitian : Untukmenguraikandanmendiskripsikanproses……… Untukmemperkirakanefek….. Terhadap…. Atauhubunganantarara…. Dan….. Untukmenjelaskan…………. Untukmengeksplorasi………… Untukmengukur…………… MANFAAT PENELITIAN Pernyataantentangmanfaatpenelitian yang menunjukansecaraeksplisitkontribusihasilpenelitiandanpengembanganteori, perumusankebijakanatauaplikasihasilpenelitianpadatingkatindividumaupunOrganisasi.

  9. KEASLIAN PENELITIAN Kemampuandalammenelusuridanmengidentifikasipenelitianterdahulu yang relevandengantopikpenelitian yang akandilakukan • Identifikasipenelitian • KerangkaTeori • Penerapanteoridalamsituasispesipikataupopulasikhusus • Generalisasiteoripadapopulasi yang lebihluas • KerangkaKonsep • Rancanganpenelitian • Instrumenpenelitian • TehnikAnalisis • Permodelan data

  10. TINJAUAN PUSTAKA Tinjauanpustakaatautelaahpustakaadalahpresentasi, klasifikasidanevaluasiapa yang telahditulisolehpeneliti-peneliti lain mengenaisuatusubyektertentu. • TinjauanPustakadisusunberdasarkan : • Tujuanpenelitian • Pertanyaanpenelitian • Masalah yang akandipecahkan TinjauanPustakamempunyai 2 bagianutamayaitu : Mulaidenganmembuatgarisbesarapa yang telahdikerjakanorang lain dalamhaltertentu yang menjadiperhatianpeneliti Secaraprogresifmenyempitmenjadikesenjangandalampenelitian ( hasilpenelitianorang lain dipergunakanuntukmempertegasdanmemperjelaskesenjanagan, kemudianpertenyaanpenelitiandanhipotesisdiajukandengantepatsebelumpenelitiandimulai)

  11. Pustaka yang telahdipublikasikanhanyadirujukbilaperluyaitu : jikapustakaitusetuju/ tidaksetujuatautidaksepenuhnyasetujudenganhipotesispeneliti. Pustaka yang tidakadahubungannyadenganbidang yang ditelititidakperludimasukandalamtinjauanpustaka. Tinjauanpustakabukanmerupakansesuaturingkasantetapisintesishasilpencarianinformasi yang disusunsecarakonseptual : Mengorganisasikaninformasi yang berhubungandenganpertanyaanpenelitian/hipotesis yang dikembangkan Mensintesishasilmenjadiringkasanmengenaiapa yang sudahdanapa yang belumdiketahui. Mengidentifikasipendapat yang adadipustaka Mengembangkanpertanyaanuntukpenelitianlebihlanjut

  12. DalamtinjauanPustakapenelitiperlumerujukpadaapa yang dilakukanolehpeneliti lain, Informasiinidapatdikelompokanmenurut : Perbedaandalampendekatan : “ Sementara Jones (1992) menganggapbahwa ….. Smith (2000) mengatakan….” Dari HubunganJauhkehubungandekat : “Baik Black (1995) dan Brown(2001) keduannyamenunjukanbahwa…. Akantetapi green (2002) memperlihatkanbahwa…..” SecaraKronologis : “Hunt (1997) dikenalkarena… tetapikemudian Douglas (1999) menunjukanbahwa…..”

  13. KerangkaTeori Akardalamsejumlahteori yang dikembangkandalamperspektif yang berbeda yang berasaldaritinjauanPustaka InformasidariBuku, Jurnal, dll Dipisahkansesuaidenganpokokteori Mempunyaihubungandengantopik TidakMempunyaihubungandengantopik Disajikandalambentukbagan

  14. Kerangkakonsep Kerangkakonsepberasaldarikerangkateoridanbiasanyaberkonsentrasipadasatubagiandarikerangkateori Lazimnyadisajikandalambentukbagan yang berisisuaturangkaiankonstrukdankonsep, definisidanproposisi yang berhubungan yang menyajikanpandangansistematistentangsuatufenomenadenganmencirikanhubunganantaravariabel-variabeldengantujuanuntukmenjelaskandanmemprediksifenomenatersebut

  15. LANDASAN TEORI Teoridasarbagipenelitian yang berisikonsep-konsepdanteori-teori yang digunakansebagaiacuandalammelakukanpenelitian. BersifatObyektif (konsepdanteori yang telahdikenaldandipahamisecaraluasolehmasyarakatpenelitidalambidang yang dimaksud. Diuraikansecarakualitatif, model-model matematis, ataurepresentatiflainnya

  16. HIPOTESIS DAN PERTANYAAN PENELITIAN Hipotesis : JawabanSementaraterhadaprumusanmasalahpenelitian (Sugiono,2009) • Pernyataandugaantentanghubunganantaraduavariabelataulebih • Berbentukkalimatpernyataan yang secaraumumataukhususmenghubungkanvariabel yang satudengan yang lainnya PenelitianEksploratif ProsedurpenelitianKualitatif TinjauanpustakatidakmenghasilkanHipotesistetapimenghasilkanpertanyaanpenelitian Ada 2 Kriteriauntukhipotesisdanpernyataanhipotesis yang baik : Pernyataanadalahhubunganantaravariabel-variabel Hipotesismengandungimplikasi yang jelasuntukmengujihubungan yang dinyatakanitu

  17. Beberapacarauntukmenentukanhipotesis : Hipotesisnol (null hypothesis) : “Tidakadaperbedaanantara A dan B” HipotesisPerbedaan (Hypotesis of difference) : “A lebihBesardibanding B” HipotesisPrevalensititik (Hypotesis of point-prevalence) : “A sekianpersendan B sekianPersen” HipotesisHubungan (Hypotesis of association) : “A tiga kali lebihbanyakdari B”

  18. METODE PENELITIAN Dalamsetiappenelitian, metodepenelitianmencakupinformasimengenai : JenisdanRancanganPenelitian, subjeckpenelitian, identifikasivariabelpenelitian, definisioperasionalvariabelpenelitian, instrumenpenelitian, caraanalisis data, etikapenelitian, keterbatasanpenetiliandan jalannyapenelitian.

  19. A. JenisdanRancanganPenelitian 1. PenelitianDeskriptip Penelitian yang dilakukanuntukmemotretsuatukondisiataufenomena yang terjadipadasuatukelompoksubjektertentu Contoh : • KajianProsesperencanaanobatdigudangfarmasikabupaten • Studitentangperananinstalasigizirumahsakitsebagaisumberpendapatan • StudiprevalensiBayiberatLahirrendah (BBLR) disuatukabupaten • KajianPersentasekasusresistensi malaria palsifarumterhadapchloroquen PenelitianDeskriptipbertujuanmengukurmagnitudosuatumasalahataufenomenatertentutanpamembuatkesimpulan yang bersifatsebabakibat.

  20. 2. PenelitianAnalitik Penelitiananalitikbertujuanuntukmengkajikausaataudeterminandarisuatufenomena. • Padapenelitiananalitikdibuatkesimpulan yang sifatnyasebabakibat • Hubungansebabakibattidakselalubersifatkausaltetapibisajugabersifatkorelasi • Determinan yang akandiukurpengaruhnyatersebutsudahterjadisebelumnya (ex post facto) dantidakdiintervensiolehpeneliti PenelitianAnalitikdibagimenjadi : • PenelitianPotongLintang (cross sectional study) • PenelitianKasusPembanding (case control study) • Kohort ( cohort study )

  21. 2. Penelitian Experimental Penelitian yang penelitinyamemilikiotoritasuntukmemberiperlakuan (intervensi) kepada subject penelitian. • Lazimnyadigunakanduaataulebihkelompokpenelitian • Tiapkelompokmenerimaperlakuan yang berbeda • Mengalokasikansecaraacakkedalamkelompokkelompoktertentu : satukelompokdialokasikansebagaikelompokperlakuandankelompoklainnyasebagaikelompokpembanding (Kelompokkontrol) Penelitianexperimendibagimenjadi 2 : Penelitianexperimenmurni ( true experimental study) Penelitianeperimental Quasi ( Quasi experimental study) Pada quasi experimental tidakdilakukanalokasi subject secaraacakkedalam kelompok2 dantidakdilakukanpengendalianvariabelpengganngu yang utama

  22. Penelitian experimental murniterdiridari : RancanganAcaklengkap ( completely randomize design) Rancanganfaktorial (Factorial design) Rancangansama Subject (Within Subject Design) RancanganPolaSilang (Cross over design) Rancangan Blok lengkapteracak (Randomized complete block design) Rancangan Block taklengkapBerimbang (Balanced incomplete block design) Rancangandalampenelitian experimental kuasi : Rancangan Pre test dan Post test (one group pre test-postedt design) Rancangan Solomon (Randomize solomon for four group design) Rancangan pre-test danpostestdengankelompokkontrol (pre test –post test with control group design)

  23. PenelitianKualitatif Penelitianuntukmemperolehsuatupemahamanmenggunakanprinsipmetodologitertentu yang mampumengeksplorasimasalahsosialataumanusia (cresswell,1988) Padapenelitianinipenelitimengembangkansesuatu yang kompleks, menganalisiskalimat, menceritakanpendapatresponden (prespektifemik), penelitiannyadikonteks yang sesungguhnya (alamiah), Rancangan, prosespengumpulan data sertastrategianalisisdilakukansecarakualitatif. PenelitianKualitatifmemilikiciri-ciri (Utarini, 2005) : DekatdenganKonteksselaluinginsedekatmungkindenganrelitakontekssesungguhnya, tidakartifisial, dannaturall setting (fakta=terjadinya) Manusiasebagai instrument Penelitianhanyamanusia yang dapatmenangkapdinamikainteraksiantarafaktadengankontekspenelitiandan yang ditelitijustrudideskritikandalampenelitiankualitatif.

  24. Lebihmemungkinkanuntukmenangkaprealitadariberbagaisudutpandang (multiple realialities) danmendiskripsikansuatusituasiataufenomenasecarakonferehesifsesuaikeadaansesungguhnya. Sampling (Pusposif sampling (sampling bertujuan). carapengumpulan data (wawancara, diskusikelompokterarah (FGD), Observasi) • NegosiasiMaknasiklusrancanganpenelitian – pengumpulan data – analisis data (prosesterjadisecarasimultan) • Validitasdanreabilitas data  truth value, aplikabilitas, konsisten, netralitas trusworthiness : apakahhasilpenelitianini trustworthy (dapatdipercaya) dan worth to trusth (bermanfaatuntukdipecaya) • PenulisanLaporanTanggungjawabpenulisadalahmenulisserincimungkinfenomena yang ditelitipadakonteks yang dipilih (case study reporting mode)

  25. 3. PenelitianStudiKasus Suatuinkuiriempiris yang menyelidikifenomenadidalamkontekskehidupan yang nyata, bilamanabatas-batasantarafenomenadankonteks yang dipelajaritidaktampakdengantegasdanbila multi sumberbuktidibutuhkan. (yin, 1994) StudiKasusdibutuhkanapabilapenelitihanyamemilikisedikitpeluanguntukmengontrolperistiwa yang akandipelajarinya (kejadianbombali) Unit analisis (fenomena yang dipelajari) : Orang, kelompok, unit tertentu, project, aktivitas, program ataupunsuatuorganisasi. • Contoh : • ImplementasisistemkomputerisasidiakademiKebidananbaktiKencana. • Evektifitassistemmanajemenkeluhandirumahsakit. • Dampakdesentralisasikesehatanterhadappemberantasanpenyakitmenular, dsb

  26. PenelitianStudiKasusdibedakanmenjadi 3 jenispenelitian : PenelitianStudiKasusEksploratif PenelitianstudiKasusDeskriptif PenelitianStudikasusExplanatori (kausal) 1. PenelitianStudiKasusEksploratif BertujuanMerumuskanpertanyaanatauhipotesisatausuatupenelitianataumenetapkankelayakandarisuatuprosedurpenelitian yang diinginkan. Pengumpulan data strategianalisis.

  27. 2. PenelitianstudiKasusDeskriptif Menyajikandiskripsilengkapdarisuatufenomena yang diamatidalamkonteks yang nyata 3. PenelitianStudikasusExplanatori (kausal) Penelitian yang berusahauntukmembuktikansuatuhubungansebabakibat, denganmenjelaskanfenomena yang diamati 4 tipedesaindalampenelitianStudiKasus : 5 komponenpenting yang harusdijelaskan : Pertanyaanpenelitian, pernyataan unit analisis, logika yang mengaitkan data denganpernyataantersebut, kriteriainterpretasitemuanpenelitian DesainkasustunggalHolistik DesainKasustunggalterpancang Desain Multi KasusHolistik Desain Multi KasusTerpancang

  28. DesainkasustunggalHolistikdanDesainKasustunggalterpancang Kasus yang dipilih mampu menjadi bukti dari teori yang telah dibangun dengan baik. Teori yang dibangun memiliki proposisi yang jelas, yang sesuai dengan kasus tunggal yang dipilih sehingga dapat dipergunakan untuk membuktikan kebenarannya. Kasus yang dipilih merupakan kasus yang ekstrim atau unik. Kasus yang dipilih merupakan kasus tipikal atau perwakilan dari kasus lain yang sama. Kasus dipilih karena merupakan kesempatan khusus bagi penelitinya. Kasus dipilih karena bersifat longitudinal, yaitu terjadi dalam dua atau lebih pada waktu yang berlainan.

  29. Desain Multi KasusHolistikdanDesain Multi KasusTerpancang Menggunakan lebih dari satu kasusdilakukan untuk mendapatkan data yang lebih detailgeneralisasi konsep atau teori yang dihasilkan. Dengan kata lain, penggunaan jumlah kasus yang banyak dimaksudkan untuk menutupi kelemahan yang terdapat pada penggunaan kasus tunggal, yang dianggap tidak dapat digeneralisasikan.

  30. SUBJEC PENELITIAN Deskripsi subject penelitianmencakupbatasanPopulasi, Besarsampeldancarapengambilansampel Populasi (Kelompok Subject yang menjadisasaranpenelitian) Manusia : Penelitianepidemiologi, penelitianprilaku, penelitianmanajemen, dll Binatang : Penelitianentomologi, Surveilansvektor, dll Benda mati : Karturekammedik, Slide pemeriksaan BTA, dll

  31. BatasanPopulasi (mendiskripsikanciri-cirikelompokkearahmanapenelitianiniakandigeneralisasikan) • Cirilokasigeografikatauadministratif(Kelurahan, Kecamatan, Kabupaten, wilayahkerjapuskesmas) • Karakteristiksubjec(Jeniskelamin, Usia, paritas, spesies) • Karakteristikpenyakit(jenispenyakit, keparahanpenyakit, jenisobat yang digunakan, jenisbangsalperawatan) PembatasanPopulasididasarkanatasmasalahdantujuanpenelitian, danbatasanpopulasidapatdinyatakandalamkriteriainklusidankriteriaEksklusi Kriteriainklusi : Batasan-batasan yang mengijinkansubjecmasukkedalampenelitian. KriteriaEksklusi : Batasan-batasansubjectidakmasukkedalampenelitian.

  32. BesarSampel SeluruhpenelitianseharusnyadilakukanterhadapseluruhanggotaPopulasi Dana, Peralatan, waktu, tenaga Sebagiandaripopulasi BESAR SAMPEL BesarSampelharusditentukandenganrumus yang sesuaidilakukanperhitunganbesarsampel dilakukanpengambilansampeldengancaratertentu. Bilapenelitiandilakukanterhadapseluruhanggotapopulasimakakata-katasampeltidakdigunakanlagi.

  33. CARA PENGAMBILAN SAMPEL Pengambilansampelmeliputi : • TehnikPengambilansampelProbabilistik • Tehnikpengambilansampel non probabilistik Tehnikpengambilansampelprobabilistik : • Pengambilansampelacaksederhana (Simple Random Sampling) • PengambilanSampelSistematik (sytematik sampling) • Pengambilansampelacakstratifikasi (stratified random sampling) • Pengambilansampelkelompok (Cluster sampling) • Pengambilansampelbertingkat (Multistage sampling)

  34. Tehnikpengambilansampel non probabilistik • Sampling Acidentalatauseadanya (accideal sampling, convenience sampling) • Sampling Purposif (Purposif sampling) • Sampling Quota (Quata Sampling) • Sampling Bola Salju (Snow ball Sampling) IDENTIFIKASI VARIABEL PENELITIAN Variabel faktor yang diamati (diteliti) dalamsuatupenelitian TinjauanPustaka  kerangkakonsep yang telahdibangun penetapanVariabelPenelitian Banyak/sedikitnyavariabelpenelitianditentukanolehpeneliti (berdasarkansumberdayadanlingkuppenelitian)

  35. Semakinbanyakvariabel yang diteliti penelitiancanggih SedikitVariabel yang diteliti  semakinartifisialpenelitianitu Variabelpenelitiandikelompokanberdasarkanfungsinya : • VariabelPengaruh (Indevendenvariabel, variabelBebas) • Variabelterpengaruh (Dependenvariabel, Variabelterikat) • VariabelPengganngu (NuissanceVariabel) • VariabelAntara (Intervening variabel) DEFINISI OPERASIONAL VARIABEL Penjelasanmengenaibagaimanasuatuvariabelakandiukursertaalatukurapa yang digunakanuntukmengukurvariabelpenelitian

  36. Alatukurstandar : Timbangan, termometer, Sphymomagnometer, indeksmasatubuh, indeksdisabilitas, Indekskaries, dll Terbuka AlatukurTidakStandar: Quisioner Tertutup (Tidakterbakukan) JikaPenelitimengembangkansendirialatukurnyamisal : Quisioner) Valid (Sahih) Try Out (UjiCoba) Mengkaji Reliabel (Terpercaya Kapan, denganmetodeapa, siapa subject yang dikenaiujicoba, analisisdatanyadanbagaimanahasilnya

  37. CARA ANALISIS DATA Cara analisis data menjelaskanbagaimanaseorangpenelitimengubah data hasilpenelitianmenjadiinformasi yang dapatdigunakanuntukmengambilkesimpulanpenelitian. Dalam Sub babinidisajikan : • Rumusrumus yang digunakan (jikamenggunakanujistatistik) • Rumusreaksikimia (Jikamenggunakananalisiskimia) • Rumuspersamaanmatematik (Jikamenggunakananalisismatematis) Padababinidisajikanjugatabelanakbawang (Dummy tabel) yang dipakaiuntukanalisisdatanya

  38. ETIKA PENELITIAN DalamBabinipenelititelahmelakukanlangkah-langkaatauprosedur yang berkaitandenganetikapenelitian, terutamaperlindunganterhadapsubjecpenelitianbaikberupamanusia, hewancoba, institusiatausistemdalaminstitusi. KETERBATASAN PENELITIAN Tidakadapenelitian yang sempurna, padababinipenelitimenyajikanketerbatasanpenelitiansecarateknis yang mungkinmempunyaidapampaksecarametodologismaupunsubstantif.

  39. JALANNYA PENELITIAN Menyajikanlangka-langkah yang dilakukanpenelitisecarakronologisdalamprosespenelitian. • Uraianinipenting, karenadapatdigunakanuntukmenilaiapakahprosespenilainmempengaruhihasilpenelitian • Diuraikanjugapenyimpangan-penyimpangandarirencanasemula yang terpaksadilakukankarenaadanyaketerbatasan-keterbatasanpenelitian • Harusdijelaskanbilapenyimpangantersebuttidakmempengaruhivaliditaspenelitian, jikahaltersebutmempengaruhi, makaharusdijelaskanupaya-upaya yang telahdilakukanolehpenelitiuntukmengurangipengaruhtersebutseminimalmungkin

  40. HASIL PENELITIAN DAN PEMBAHASAN Dapatdisajikandalam 3 jenispenyajian : • PenyajianTekstual • Penyajian Tabular • PenyajianGrafik Tekstual + Tabular Tekstual + Grafik PenyajianTekstual : wajibmendeskripsikan data sejelasdanseterperincimungkinnamuntidakharusmenyajilkansemuahal. • Persentase (frekwensi) terbesar, Persentase (frekwensi) terkecil, rerataterbesar, rerataterkecil, perbedaanselisihterbesar, perbedaanselisihterkecildanperbedaanatauhubungan yang bermakna.

  41. Beberapahal yang perludiperhatikanpadasaatmembuattabel : Data yang disajikansudahdiolah (dikelompokandalamkatagori-katagori, interval-interval, atausudahdihitungukuran-ukurandeskripsinya), bukan data kasar. Data Kasardirangkumdalamtabel master dandiletakandidalamlampiran Katagoridalamtabeldapatmenggunakankolomsajaataubarissajaataukedua-duanya (tabelsilang (cross tabulation), Tabulasidapatbersifatkuantitatif, kualitatifataukombinasikeduanya Kecualipenyajiantabeluntukmenghitung OR (odds ratio) dan RR (Risk Ratio) makavariabelpengaruhdiletakanpadakolomdanvariabelterpengaruhpadabaris

  42. 4. TabelHarusSederhana agar mudahdipahamipembaca, artinyadalamsatutabeljanganterlalubanyakdimasukaninformasi, jikainformasi yang akandisajikanbanyakmakadisajikandalambeberapatabel. 5. PenyajianTabelharusindependen ( untukmemahamiisitabel, pembacatidakperluharusmembacateksnyaterlebihdahulu) ataudapatmenerangkandidinyasendiri (Self explanation) harusberisipenjelasanlengkap : berkaitandenganjudul, kode/simbol yang digunakan, label padakolomdanbarisdansumber data. 6. Judultabeldibuatseringkasdansejelasmungkin (Apa, DimanadanKapan), ditulisdiatastabeldenganposisiditengahtabel, dengan format kerucutterbalik.

  43. 7. Bilatabelmenggunakansimbol-simbol (terutama yang jarangdigunakan, misal N = newton, ukurantekanan) haruslahdijelaskan. 8. Katagoriatau label sebagaikepalakolomdanbarisharusditulisdenganjelas 9. Keterangan yang berkaitandenganisitabel, ditulisdibagianbawahkiritabel. 10. Bilatabelmenyajikan data skunder, harusdisebutkansumber data tersebut, sumberditulisdibawahkanantabel. 11. Tabeltidakbolehdipotong (disajikanpadaduahalaman yang berbeda)

  44. Beberapahal yang perludiperhatikandalammembuatgrafik : • Sepertitabel. Grapikharusdibuatsederhanadanjelas, dalamgrafikdisajikantidaklebihduavariabelsaja, bilavariabel yang disajikanbanyakmakadisajikandalambeberapagrafik. • Grafikharus self-explanation • Jikatidakdiperlukangrafiktidakperludigambardalam 3 dimensi • Judulgrafikharusringkasdanjelas ( Apa, Dimanadankapan) judulgrafikditulisdibawahgrafik, ditengahdengan format kerucutterbalik. • Judulsebuahgrafiktidakmenggunakanistilah (kata) GrafikmelainkanGambar. Gambar (figure) mencakup, grafik, gambar, sketsa, peta, foto, skema (misalnyakerangkakonsep)

  45. CARA PENULISAN KTI Penulisan KTI menggunakanmetodeHardvard. Mencantumkanrefrensisetiappernyataandidalam KTI yang bukanasliberasaldariPenulis. Refrensiharusdicantumkanpada : Setiapinformasidarisumber lain, baik yang merupakanQuotasilangsungataupun yang telahdiparafraseatausintesis. Data, misalnya : Data demografidll. TeoriatauGagasanPenulis Lain Gambar, Baganataugrafik yang berasaldarisumber lain (Artikelpublikasicetakmaupunelektronik, dll)

  46. SistemHardvard : Hanyanamabelakangdantahunterbitnyatulisan yang dicantumkandalamTeks PenulisandalamTeksdapatdikelompokansbb : 1. Tulisanolehsatupenulis Contoh: Agyepong (1992) mengeksplorasi ... DalampenelitianmengenaipersepsimasyarakatdimasyarakatAdangbe, Agyepong (1992) menemukan ... MenurutAgyepong (1992), ... Padatahun 1992, Agyepongmengeksplorasi ... Penelitiansebelumnyamenunjukkanbahwa.... (Agyepong, 1992)

  47. 2. Tulisanolehduapenulis • Apabilaterdapatduapenulis, keduanamapenulisharusselaludicantumkan.Contoh: • Espino and Manderson (2000) dalam suatu studi di Filipina menemukan ... • Studi di Filipina (Espino & Manderson, 2000) ... • 3. Tulisanolehlebihdariduapenulis • Apabilaterdapatlebihdariduapenulis, cantumkannamabelakangpenulispertamasajaditambahet al. (kata et al. dicetak miring) • Contoh: • Aikins et at (1993) menyatakan ... • Penelitiansebelumnyamenunjukkanbahwa.... (Aikinset al., 1993)

  48. 4. Institusisebagaipenulis Pertama kali dirujuk dalam teks: DepartemenKesehatan (Depkes) (1993) ... Hasilsurveikesehatandi Indonesia ... (DepartemenKesehatan (Depkes), 1991) Depkes (1993) ... Hasil survei kesehatan di Indonesia ... (Depkes, 1993) Dalam daftar pustaka (Iihat Petunujuk Penulisan Referensi Dalam Daftar Pustaka):

  49. 5. Apabilaterdapatduaataulebihtulisanolehpenulis yang sama, danmerupakansumberdariparagraf yang sama, bila... • 1)dipublikasikan pada tahun yang sama, maka ditambahkan hurut kecil (a,b,c, ...) sebagai tanda. Cara penulisan referensi dalam Daftar Pustaka mengikuti • DuapenelitianolehAgyepongdi Manila menunjukkan... (Agyepong 1992a,b) • 2)dipublikasikanpadatahun yang berbeda, makadicantumkantahunpublikasinyasecaraberurutan • Bloggs (1992, 1994) dalam teorinya mengatakan ... Penelitian sebelumnya (Edeline & Weinberger, 1991, 1993)