1 / 45

“Targeting Thymidylate Synthase in Cancer Therapy” F.G. Berger Department of Biological Sciences

“Targeting Thymidylate Synthase in Cancer Therapy” F.G. Berger Department of Biological Sciences Center for Colon Cancer Research University of South Carolina. Thymidylate synthase (TS). Catalyzes the conversion of dUMP into dTMP. Figure adapted from Lehninger. N. C.

luke
Télécharger la présentation

“Targeting Thymidylate Synthase in Cancer Therapy” F.G. Berger Department of Biological Sciences

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. “Targeting Thymidylate Synthase in Cancer Therapy” F.G. Berger Department of Biological Sciences Center for Colon Cancer Research University of South Carolina

  2. Thymidylate synthase (TS) Catalyzes the conversion of dUMP into dTMP Figure adapted from Lehninger

  3. N C

  4. Thymidylate Synthase Inhibitors: 5-Fluoro-2’-deoxyuridine (FdUrd) 5-Fluorouracil (FUra)

  5. Longley et al. Nature Reviews Cancer3:330 (2003)

  6. Control TNFα FUra FUra FdUrd FdUrd RTX

  7. Role of post-translational processes in TS function: ● Degradation of the TS polypeptide ● SUMO modification of TS ● Nuclear localization

  8. E. Chu and C.Allegra. 1999. Adv Enzyme Regul. 36:143-63.

  9. Intracellular stability of human TS HCT15 HCT15/200

  10. Polysome profiles for TS mRNA Kitchens, M. E. et al. 1999. J. Biol. Chem. 274:12544-12547

  11. ● TS is degraded intracellularly by the 26S proteasome. ●TS is not ubiquitinylated. ●Abrogation of the ubiquitin ligation pathway does not alter TS degradation. ● Conversion of all Lys residues to Arg does not stabilize the TS polypeptide. Therefore, the TS polypeptide is degraded in a ubiquitin-independent manner.

  12. Role of the N-terminus in TS degradation

  13. The N-terminal region of human TS destabilizes E. coli TS

  14. The N-terminal region of human TS destabilizes GFP

  15. Role of the penultimate residue in TS degradation. t1/2≤ 12 h t1/2≥ 36 h

  16. N-terminal processing of the TS polypeptide: ● Methionine excision ● N-α-acetylation * From Meinnel et al. 2005.Biochimie 87, 701-712.

  17. Human Pro2 - Val3 - Ala4 - Gly5---- Mouse Ac-Met1 - Leu2 - Val3 - Val4 - Gly5---- Rat Ac-Met1 - Leu2 - Val3 - Glu4 - Gly5----

  18. 2D Western blots of human TS

  19. 2D Western blots of TS/GFP fusions

  20. 210 PVAGSELPR

  21. Yeast two-hybrid screen Bait: hTS-(1-313) Gal4-BD Prey Human Placental c-DNA library fused to the C-terminus of Gal4-AD

  22. Bait Plasmids Identified

  23. ● UBC9 is a conjugating enzyme required for protein sumoylation, and has been implicated in regulating several critical cellular pathways. ●SUMO is activated for conjugation by the E1 enzyme AOS/UBA2, transferred to the E2 conjugation enzyme UBC9, and finally conjugated to target proteins.

  24. ●Known target proteins of sumoylation include p53, MDM2, PML, RanGAP1, IκB, androgen receptor, and c-Jun. ●Modification of these proteins by sumoylation changes their subcellular localization, function, and/or stability. ●Sumoylation is reversible, and there are at least seven mammalian SUMO-specific proteases, which are designated the SENP family proteins.

  25. In vitro TS sumoylation occurs, and requires all components of sumoylation pathway TS + mSUMO-1 TS + SUMO-1 No Protein TS + E1 TS + E2 TS only TS-SUMO1 WB: Anti-hTS Ab TS

  26. Formation of Inhibitory Ternary Complex blocks TS Sumoylation _____TS + SUMO1_____ Sumoylated TS + CH2THF + FdUMP TS + CH2THF + FdUMP + CH2THF + FdUMP + CH2THF only + FdUMP only TS only - TS-SUMO1 * * * TS * - inhibitory ternary complex

  27. - Ψ is bulky hydrophobic residue, X is any residue Ψ-K-X-E Consensus SUMO ligation sites in TS Site A (K284) Site C (K308) Site B (K292)

  28. 281 313 ● ● Human TS: …ILRKVEKIDDFKAEDFQIEGYNPHPTIKMEMAV Mouse TS: T V Rat TS: T V

  29. K308 is the site of TS sumoylation TnT-Coupled in vitro Translated human TS K284R K292R K308R Site B K292A Site C K308R K284R K292R No plasmid Site A K284R WT 1 2 1 2 1 2 1 2 1 2 1 2 1 2 hTS-SUMO1 hTS 1 – in vitro synthesized TS 2 – in vitro synthesized TS + SUMO1

  30. Fluorescence complementation assay Fang, Deyu and Kerppola (2004) Proc. Natl. Acad. Sci. USA 101, 14782-14787

  31. CC YN SUMO1 TS K308 SUMO1 + TS

  32. Confocal microscopy of HeLa-55 cells stained by immunofluorescence for thymidylate synthase (TS) Bissoon-Haqqani, S. et al. J. Histochem. Cytochem. 2006;54:19-29

  33. Ligands inhibit TS accumulation in the nucleus

  34. Such ligand-mediated inhibition of nuclear TS accumulation is not a consequence of DNA damage

  35. TS localization to the nucleus is also modulated by residue K308, but does not require sumoylation at this site

  36. “Working” Model for nuclear import of TS: (1.) C-terminal end (including K308) of TS is required for its binding to the nuclear periphery. (2.) This is abrogated by either ligands or the K308A mutation. (3.) TS goes through a sumoylation/desumoylation cycle as it enters the nucleus. (4.) This determines the enzyme’s intra-nuclear locale. Ligands affect exposure of C-terminal region; Sumoylation affects intra-nuclear locale, but not entry.

  37. High nuclear TS levels in colorectal tumors are associated with poorer survival: M. Gustavson et al. AACR Conference on Molecular Diagnostics in Cancer Therapeutic Development (Chicago, IL., Sept. 2006)

  38. Could the cytotoxicity of TS inhibitors derive from abrogation of the enzyme’s nuclear accumulation, and subsequent effects on DNA repair?

  39. Marj Peña Kenn White Karen Barbour Sandra Melo Yang Yang Xing

More Related