'Maldi' diaporamas de présentation

968 views • 82 slides

Mass Spectrometry

Mass Spectrometry. 2012 Fall version dslee@swu.ac.kr. Basic theory of mass spectrometry

2.32k views • 81 slides

Mass Spectrometry

Mass Spectrometry. 2012 Fall version dslee@swu.ac.kr. Basic theory of mass spectrometry

2.32k views • 81 slides

Frederick SANGER (1918-)

1958 Nobel Prize in Chemistry: for his work on the structure of proteins, especially that of insulin. GIVEQCCASVCSLYQLENYCN PVNQHLCGSHLVEALYLVCGERGFFYTPKA. Frederick SANGER (1918-).

1.24k views • 81 slides

530 views • 40 slides

Modern drug discovery techniques

723 views • 30 slides

Chapter 13 Glycobiology and proteomics

Chapter 13 Glycobiology and proteomics. ????? ???????? ???. 1. Introduction 2. What is a glycoprotein ? 2.1. N-linked structure 2.2. O- linked structure 2.3. GPI-anchored structure

775 views • 29 slides

WOW Project Review

WOW Project Review. Friday 2 nd October 2009 Chemistry. Introduction. Degradation Bacterial degradation of lignin. Assay and bio-prospecting Extractions Improvements and alternative methods Analysis Identification of compounds Materials Uses and potential markets of breakdown products

393 views • 29 slides

High-throughput genotyping

High-throughput genotyping. What is genotyping?. the analysis of DNA-sequence variation genotype = the genetic constitution of an individual. Alleles. alternative form of a gene or DNA sequence at a specific chromosomal location (locus)

1.17k views • 26 slides

Proc. Natl. Acad. Sci. USA 105: 21034-21038 (2008) .

Proc. Natl. Acad. Sci. USA 105: 21034-21038 (2008) .

412 views • 22 slides

Analyzing Biological and Organic Polymers by MALDI-TOF

Analyzing Biological and Organic Polymers by MALDI-TOF. Jonathan A. Karty, Ph.D. Topics Covered. Sample Requirements Instrument Overview General Instrument Use Instructions Tips and Tricks. What is the Bruker Autoflex III?. Time-of-flight mass spectrometer

399 views • 22 slides

Mass Spectrometry

Mass Spectrometry. Instrumentation: Ionization methods and analyzers. Parts of an MS. Ionization Methods. EI CI FD FAB MALDI ES. EI (and CI). EI vs CI. FD. http://en.wikipedia.org/wiki/Field_desorption

1.89k views • 21 slides

BioGrids: Why Should Biologists Care?

278 views • 16 slides

Reaction discovery enabled by DNA-templated synthesis and in vitro selection

Reaction discovery enabled by DNA-templated synthesis and in vitro selection. Matthew W. Kanan, Mary M. Rozenman, Kaori Sakurai, Thomas M. Snyder & David R. Liu. Nature, vol.431, 2004. Presented by Seok, Ho-Sik. What they did?.

290 views • 15 slides

Yuwei Qian, Werner Ens, Ken G Standing

Developing Methods for Identifying. Polypeptides from Barley Wort Using. MALDI TOF Mass Spectrometry. Yuwei Qian, Werner Ens, Ken G Standing Physics and Astronomy, University of Manitoba, Winnipeg, MB, Canada Marta Izydorczyk, Sharon Bazin, Ken Preston

193 views • 12 slides

3.5

pH. 3.5. 11. 200. 116. 6. 5. 1. 2. 4. 3. 97. 10. 11. 7. 9. 8. 12. 13. 67. 14. 16. 15. 18. 19. 17. 45. 20. kDa. 22. 31. 21. 25. 24. 26. 23. 21. 29. 30. 27. 14. 28. 33. 32. 31. 6.

158 views • 6 slides