'Parsimony' diaporamas de présentation

Parsimony, Likelihood, Common Causes, and Phylogenetic Inference

714 views • 62 slides

Classification & Clustering

Classification & Clustering. Pieter Spronck http://www.cs.unimaas.nl/p.spronck. Binary Division of Marbles. Big vs. Small. Transparent vs. Opaque. Marble Attributes. Size (big vs. small) Transparency (transparent vs. opaque) Shininess (shiny vs. dull)

751 views • 60 slides

Parsimony & Probability

Parsimony & Probability. Under what circumstances is the character vector [ 0 11 00 ] more probable given tree A than given tree B? I.e., under what circumstances is tree A more likely than tree B given [ 0 11 00 ]?. Parsimony & Probability. P[change] is the same on each branch;

670 views • 56 slides

Combinatorial and graph-theoretic problems in evolutionary tree reconstruction

683 views • 53 slides

ISBRA 2007 Tutorial A: Scalable Algorithms for Genotype and Haplotype Analysis

ISBRA 2007 Tutorial A: Scalable Algorithms for Genotype and Haplotype Analysis. Ion Mandoiu (University of Connecticut) Alexander Zelikovsky (Georgia State University). Outline. Background on genetic variation Genotype phasing Error detection Disease association search

641 views • 45 slides

489 views • 34 slides

Chapter 3

503 views • 34 slides

Research on Scared Straight Type Programs (1968-1992)

649 views • 30 slides

536 views • 29 slides

a -globin ( 141) and b -globin (146)

Optimisation Alignment. http://www.stats.ox.ac.uk/~hein/lectures.htm. a -globin ( 141) and b -globin (146) V-LSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS--H---GSAQVKGHGKKVADAL VHLTPEEKSAVTALWGKV--NVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAF

353 views • 26 slides

Modeling Cycles By ARMA

353 views • 25 slides

BNFO 602 Phylogenetics

BNFO 602 Phylogenetics. Usman Roshan. Summary of last time. Models of evolution Distance based tree reconstruction Neighbor joining UPGMA. Why phylogenetics?. Study of evolution Origin and migration of humans Origin and spead of disease Many applications in comparative bioinformatics

410 views • 23 slides

PARADIGMS

PARADIGMS. These are frames of reference that are used for understanding things Different paradigms suggest different theories that in turn inspire different types of research. Different Paradigms

586 views • 19 slides

Coordination

385 views • 19 slides

Hickory Dickory Dock: Understanding the Molecular Clock

336 views • 18 slides

Science and Psychology

Science and Psychology. Psych 231: Research Methods in Psychology. Blackboard accounts should now work Office hours are now posted Dr. Cutting: M 11-12, W 2-3 Degarmo 435D Kevin Wallpe: Tu 9-10 Degarmo 12 JD Hogue: W 9-10 Degarmo 12C. Announcements.

253 views • 16 slides

CHAPTER 4 Conceptualize Phase

246 views • 13 slides

INTRODUCTION TO QUALITATIVE RESEARCH IN EDUCATION

1.76k views • 13 slides

Phylogenetic Tree

Phylogenetic Tree. A Phylogeny (Phylogenetic tree) or Evolutionary tree represents the evolutionary relationships among a set of organisms or groups of organisms a family related nucleic acid or protein sequences Every phylogenetic tree is an hypothesis about relationships

7.09k views • 12 slides

Crafting Research

333 views • 10 slides