Supplementary fig - PowerPoint PPT Presentation
Supplementary Fig . 1
Supplementary Fig . 1. a DF strain. b DHF strain. c DHF strain. Plasma dengue vRNA copies / ml ( log). Days post inoculation.
By shanna
Supplementary Fig. 1
Supplementary Fig. 1 Associations between TERT promoter mutations and typical genetic alterations in glial tumors . Abbreviations : PXA = pleomorphic xanthoastrocytoma ; A II = astrocytoma WHO grade II; A III = astrocytoma WHO grade III; LOH = loss of herterogeneity ;
By aysel
C70-Goody ball-65
C268-Beltis. I. B2145-Ironman. B2145-Ironman. II. B2138-Marathon. C295-Atria. B2085-Green Belt. C33-Green Express. C70-Goody ball 65. B2198-Green Dome. C70-Goody ball-65. B2061-Fighter. B2198-Green Dome. C217-Ogane. C157-Blue Vantage. C217-Ogane. B2056-Heart Land.
By tirza![N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]](https://thumbs.slideserve.com/1_2369080.jpg)
N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]
Supplementary Fig. 1. Amino acid sequence and predicted domains of the expressed protein. N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124] Sequence ID: ref|YP_696189.1| Length: 337 1 MKIAVRGGHNFKAKGALGIIDETIENRKVYKALIKYLNIAGHNVIDVTPGECDINTDLYL 60
By zariel
ACOT9 Phylogenetic tree
Supplementary Fig. 2. Mammals. Birds. ACOT9 Phylogenetic tree. Ray- finned fish. Inverte - brates. *. *. Insects. *. *. Plants. Bacteria. Fungi. *. *. Nematode.
By makala
BBWV-2
Supplementary Fig. 3. b. a. mock. BBWV-2. inoculated leaf. mock. BBWV-2. upper leaf. c. inoculated leaf. mock. BBWV-2. mock. BBWV-2. d. mock. BBWV-2. inoculated leaf. upper leaf. mock. BBWV-2. upper leaf.
By brock
Supplementary Fig . 1
D. Molar. Incisor. ODB. *. *. *. *. ODB. b. a. Supplementary Fig . 1 . Osteopontin. BSP. DSP. B . B . B . Bone. a. b. c. D . D . D . Dentin. ODB . ODB . ODB . d. e. f. Supplementary Fig . 2 .
By mckile
Supplementary Fig. 1
mkk3DN. mkk6DN. control. –. +. SB202190. –/–. –/–. +/ –. +/ –. mkk7. –. –. –. UV. CycB1 k.a. GST-ATF2. CDC2. GST-c-Jun. CycD1 k.a. Actin. Mkk6DN. Cdk4. MKK3DN. +. +. +. a. Supplementary Fig. 1. b.
By medea
Adult Liver
Amino acid In vitro recapitulation of the urea cycle using murine embryonic stem cell derived in vitro liver model Miho Tamai, Mami Aoki, Akihito Nishimura, Koji Morishita, and Yoh-ichi Tagawa *
By halil
Supplementary Fig 1
Supplementary Fig 1. % cells with subG0/G1 DNA content. 0. 0. 0. 0. 90. 60. min. 90. 60. 90. 60. 90. 60. 120. 120. 120. 120. U937 Vector Control NPM-RAR NPM-RAR Clone 7 Clone 10.
By suchi
Supplementary Fig. 1
DraI. DraI. DraI. 4.3 kb. X. X. pta. als. ( ldhA als ). ldhA. Probe pta. DraI. DraI. Probe apr. X. X. apr. als. ( ldhA als pta ). ldhA. 6.3 kb. ( ldhA als pta ). ( ldhA als pta ). ( ldhA als ). ( ldhA als ). 6.3 kb. 4.3 kb. (Probe pta ). (Probe apr ).
By isaura
Supplementary Fig.1
Supplementary Fig.1. Frozen sample. FFPE sample. AA045 IDH1 R132H. AO036 IDH1 R132H. GBM155 IDH1 wt.
By armen
Tetep
Nipponbare. O . rufipogon. Grandiglumis. Caloro. HP2216. O. nivara. Tetep. O. rhizomatis. Bhrigudhan. K-60. Co-39. O . minuta. O. punctata. Jatto. O. latifolia. O . officinalis. 1bp. 500. 1000. 2000bp. 1500.
By elom
Supplementary Fig. S1.
Supplementary Fig. S1. Supplementary Fig. S2. Supplementary Fig. S3. Supplementary Fig. S4.
By chaela
Supplementary Fig . 1
Supplementary Fig . 1. a. pGBM (154). AA (44). DA (17). 3. IDH. IDH. IDH. 1. 1. 1. 2. 1. 6. 23. TP53. 3. 1. 5. 40. 89. 3. 5. 10. TERT. TERT. TP53. TP53. TERT. None=6. None=10. None=5. All tumors ( 304 ). OL/AO/OA/AOA (83 ). IDH. TERT. 4. 98. 1. 15. 40. 4.
By kiara
Actin
Supplementary Figure S1. Lee et al. PEA-15. Actin. Hey. 2774. RMG-1. KOC-7c. OVTOKO. OVCA420. OVCA432. SKOV3.ip1.
By fay
Supplementary Fig. 1
Supplementary Fig. 1. Supplementary Fig. 2. (a). (b). (c). PL1. PL1. PL2. PL2. PG (C 20 –C 20 ). PG (C 20 –C 20 ). PG (C 20 –C 25 ). PG (C 20 –C 25 ). PL3. PL3. PL4. PGL1. PL4. PGL1. PGL2. PGL1. PGP-ME. PGL2. PGL2. PGP-ME. PL5. PL6. PL5. PL6. PGL3. PGL3. PGL4. PGL4.
By gauravView Supplementary fig PowerPoint (PPT) presentations online in SlideServe. SlideServe has a very huge collection of Supplementary fig PowerPoint presentations. You can view or download Supplementary fig presentations for your school assignment or business presentation. Browse for the presentations on every topic that you want.