Supplementary Fig . 1. a DF strain. b DHF strain. c DHF strain. Plasma dengue vRNA copies / ml ( log). Days post inoculation.
By shannaSupplementary Fig. 1 Associations between TERT promoter mutations and typical genetic alterations in glial tumors . Abbreviations : PXA = pleomorphic xanthoastrocytoma ; A II = astrocytoma WHO grade II; A III = astrocytoma WHO grade III; LOH = loss of herterogeneity ;
By ayselC268-Beltis. I. B2145-Ironman. B2145-Ironman. II. B2138-Marathon. C295-Atria. B2085-Green Belt. C33-Green Express. C70-Goody ball 65. B2198-Green Dome. C70-Goody ball-65. B2061-Fighter. B2198-Green Dome. C217-Ogane. C157-Blue Vantage. C217-Ogane. B2056-Heart Land.
By tirzaSupplementary Fig. 1. Amino acid sequence and predicted domains of the expressed protein. N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124] Sequence ID: ref|YP_696189.1| Length: 337 1 MKIAVRGGHNFKAKGALGIIDETIENRKVYKALIKYLNIAGHNVIDVTPGECDINTDLYL 60
By zarielSupplementary Fig. 2. Mammals. Birds. ACOT9 Phylogenetic tree. Ray- finned fish. Inverte - brates. *. *. Insects. *. *. Plants. Bacteria. Fungi. *. *. Nematode.
By makalaSupplementary Fig. 3. b. a. mock. BBWV-2. inoculated leaf. mock. BBWV-2. upper leaf. c. inoculated leaf. mock. BBWV-2. mock. BBWV-2. d. mock. BBWV-2. inoculated leaf. upper leaf. mock. BBWV-2. upper leaf.
By brockD. Molar. Incisor. ODB. *. *. *. *. ODB. b. a. Supplementary Fig . 1 . Osteopontin. BSP. DSP. B . B . B . Bone. a. b. c. D . D . D . Dentin. ODB . ODB . ODB . d. e. f. Supplementary Fig . 2 .
By mckilemkk3DN. mkk6DN. control. –. +. SB202190. –/–. –/–. +/ –. +/ –. mkk7. –. –. –. UV. CycB1 k.a. GST-ATF2. CDC2. GST-c-Jun. CycD1 k.a. Actin. Mkk6DN. Cdk4. MKK3DN. +. +. +. a. Supplementary Fig. 1. b.
By medeaAmino acid In vitro recapitulation of the urea cycle using murine embryonic stem cell derived in vitro liver model Miho Tamai, Mami Aoki, Akihito Nishimura, Koji Morishita, and Yoh-ichi Tagawa *
By halilSupplementary Fig 1. % cells with subG0/G1 DNA content. 0. 0. 0. 0. 90. 60. min. 90. 60. 90. 60. 90. 60. 120. 120. 120. 120. U937 Vector Control NPM-RAR NPM-RAR Clone 7 Clone 10.
By suchiDraI. DraI. DraI. 4.3 kb. X. X. pta. als. ( ldhA als ). ldhA. Probe pta. DraI. DraI. Probe apr. X. X. apr. als. ( ldhA als pta ). ldhA. 6.3 kb. ( ldhA als pta ). ( ldhA als pta ). ( ldhA als ). ( ldhA als ). 6.3 kb. 4.3 kb. (Probe pta ). (Probe apr ).
By isauraSupplementary Fig.1. Frozen sample. FFPE sample. AA045 IDH1 R132H. AO036 IDH1 R132H. GBM155 IDH1 wt.
By armenNipponbare. O . rufipogon. Grandiglumis. Caloro. HP2216. O. nivara. Tetep. O. rhizomatis. Bhrigudhan. K-60. Co-39. O . minuta. O. punctata. Jatto. O. latifolia. O . officinalis. 1bp. 500. 1000. 2000bp. 1500.
By elomSupplementary Fig. S1. Supplementary Fig. S2. Supplementary Fig. S3. Supplementary Fig. S4.
By chaelaSupplementary Fig . 1. a. pGBM (154). AA (44). DA (17). 3. IDH. IDH. IDH. 1. 1. 1. 2. 1. 6. 23. TP53. 3. 1. 5. 40. 89. 3. 5. 10. TERT. TERT. TP53. TP53. TERT. None=6. None=10. None=5. All tumors ( 304 ). OL/AO/OA/AOA (83 ). IDH. TERT. 4. 98. 1. 15. 40. 4.
By kiaraSupplementary Figure S1. Lee et al. PEA-15. Actin. Hey. 2774. RMG-1. KOC-7c. OVTOKO. OVCA420. OVCA432. SKOV3.ip1.
By faySupplementary Fig. 1. Supplementary Fig. 2. (a). (b). (c). PL1. PL1. PL2. PL2. PG (C 20 –C 20 ). PG (C 20 –C 20 ). PG (C 20 –C 25 ). PG (C 20 –C 25 ). PL3. PL3. PL4. PGL1. PL4. PGL1. PGL2. PGL1. PGP-ME. PGL2. PGL2. PGP-ME. PL5. PL6. PL5. PL6. PGL3. PGL3. PGL4. PGL4.
By gauravView Supplementary fig PowerPoint (PPT) presentations online in SlideServe. SlideServe has a very huge collection of Supplementary fig PowerPoint presentations. You can view or download Supplementary fig presentations for your school assignment or business presentation. Browse for the presentations on every topic that you want.