'Supplementary fig' diaporamas de présentation

Supplementary fig - PowerPoint PPT Presentation

Supplementary Fig. 1

Supplementary Fig. 1

Stage 1. Stage 2. Stage 3. Supplementary Fig. 1

By lois

Supplementary Fig . 1

Supplementary Fig . 1

Supplementary Fig . 1. a DF strain. b DHF strain. c DHF strain. Plasma dengue vRNA copies / ml ( log). Days post inoculation.

By shanna

Supplementary Fig. 1

Supplementary Fig. 1

Supplementary Fig. 1 Associations between TERT promoter mutations and typical genetic alterations in glial tumors . Abbreviations : PXA = pleomorphic xanthoastrocytoma ; A II = astrocytoma WHO grade II; A III = astrocytoma WHO grade III; LOH = loss of herterogeneity ;

By aysel

C70-Goody ball-65

C70-Goody ball-65

C268-Beltis. I. B2145-Ironman. B2145-Ironman. II. B2138-Marathon. C295-Atria. B2085-Green Belt. C33-Green Express. C70-Goody ball 65. B2198-Green Dome. C70-Goody ball-65. B2061-Fighter. B2198-Green Dome. C217-Ogane. C157-Blue Vantage. C217-Ogane. B2056-Heart Land.

By tirza

N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124]

Supplementary Fig. 1. Amino acid sequence and predicted domains of the expressed protein. N-acetylmuramoyl-L-alanine amidase [Clostridium perfringens ATCC 13124] Sequence ID: ref|YP_696189.1| Length: 337 1 MKIAVRGGHNFKAKGALGIIDETIENRKVYKALIKYLNIAGHNVIDVTPGECDINTDLYL 60

By zariel

ACOT9 Phylogenetic tree

ACOT9 Phylogenetic tree

Supplementary Fig. 2. Mammals. Birds. ACOT9 Phylogenetic tree. Ray- finned fish. Inverte - brates. *. *. Insects. *. *. Plants. Bacteria. Fungi. *. *. Nematode.

By makala



Supplementary Fig. 3. b. a. mock. BBWV-2. inoculated leaf. mock. BBWV-2. upper leaf. c. inoculated leaf. mock. BBWV-2. mock. BBWV-2. d. mock. BBWV-2. inoculated leaf. upper leaf. mock. BBWV-2. upper leaf.

By brock

Supplementary Fig . 1

Supplementary Fig . 1

D. Molar. Incisor. ODB. *. *. *. *. ODB. b. a. Supplementary Fig . 1 . Osteopontin. BSP. DSP. B . B . B . Bone. a. b. c. D . D . D . Dentin. ODB . ODB . ODB . d. e. f. Supplementary Fig . 2 .

By mckile

Supplementary Fig. 1

Supplementary Fig. 1

mkk3DN. mkk6DN. control. –. +. SB202190. –/–. –/–. +/ –. +/ –. mkk7. –. –. –. UV. CycB1 k.a. GST-ATF2. CDC2. GST-c-Jun. CycD1 k.a. Actin. Mkk6DN. Cdk4. MKK3DN. +. +. +. a. Supplementary Fig. 1. b.

By medea

By keiji

Adult Liver

Adult Liver

Amino acid In vitro recapitulation of the urea cycle using murine embryonic stem cell  derived in vitro liver model Miho Tamai, Mami Aoki, Akihito Nishimura, Koji Morishita, and Yoh-ichi Tagawa *

By halil

Supplementary Fig 1

Supplementary Fig 1

Supplementary Fig 1. % cells with subG0/G1 DNA content. 0. 0. 0. 0. 90. 60. min. 90. 60. 90. 60. 90. 60. 120. 120. 120. 120. U937 Vector Control NPM-RAR NPM-RAR Clone 7 Clone 10.

By suchi

Supplementary Fig. 1

Supplementary Fig. 1

DraI. DraI. DraI. 4.3 kb. X. X. pta. als. ( ldhA als ). ldhA. Probe pta. DraI. DraI. Probe apr. X. X. apr. als. ( ldhA als pta ). ldhA. 6.3 kb. ( ldhA als pta ). ( ldhA als pta ). ( ldhA als ). ( ldhA als ). 6.3 kb. 4.3 kb. (Probe pta ). (Probe apr ).

By isaura

Supplementary Fig.1

Supplementary Fig.1

Supplementary Fig.1. Frozen sample. FFPE sample. AA045 IDH1 R132H. AO036 IDH1 R132H. GBM155 IDH1 wt.

By armen



Nipponbare. O . rufipogon. Grandiglumis. Caloro. HP2216. O. nivara. Tetep. O. rhizomatis. Bhrigudhan. K-60. Co-39. O . minuta. O. punctata. Jatto. O. latifolia. O . officinalis. 1bp. 500. 1000. 2000bp. 1500.

By elom

Supplementary Fig. S1.

Supplementary Fig. S1.

Supplementary Fig. S1. Supplementary Fig. S2. Supplementary Fig. S3. Supplementary Fig. S4.

By chaela

Supplementary Fig . 1

Supplementary Fig . 1

Supplementary Fig . 1. a. pGBM (154). AA (44). DA (17). 3. IDH. IDH. IDH. 1. 1. 1. 2. 1. 6. 23. TP53. 3. 1. 5. 40. 89. 3. 5. 10. TERT. TERT. TP53. TP53. TERT. None=6. None=10. None=5. All tumors ( 304 ). OL/AO/OA/AOA (83 ). IDH. TERT. 4. 98. 1. 15. 40. 4.

By kiara




By xerxes



Supplementary Figure S1. Lee et al. PEA-15. Actin. Hey. 2774. RMG-1. KOC-7c. OVTOKO. OVCA420. OVCA432. SKOV3.ip1.

By fay

Supplementary Fig. 1

Supplementary Fig. 1

Supplementary Fig. 1. Supplementary Fig. 2. (a). (b). (c). PL1. PL1. PL2. PL2. PG (C 20 –C 20 ). PG (C 20 –C 20 ). PG (C 20 –C 25 ). PG (C 20 –C 25 ). PL3. PL3. PL4. PGL1. PL4. PGL1. PGL2. PGL1. PGP-ME. PGL2. PGL2. PGP-ME. PL5. PL6. PL5. PL6. PGL3. PGL3. PGL4. PGL4.

By gaurav

View Supplementary fig PowerPoint (PPT) presentations online in SlideServe. SlideServe has a very huge collection of Supplementary fig PowerPoint presentations. You can view or download Supplementary fig presentations for your school assignment or business presentation. Browse for the presentations on every topic that you want.