tambre
Uploaded by
14 SLIDES
646 VUES
140LIKES

Review Introduction

DESCRIPTION

Review Introduction. Talent Scouting untuk PTN Baru dan Universitas di Wilayah Indonesia Timur Politeknik Negeri Nusa Utara Tahuna , Sangihe , Sulawesi Utara 10-12 Oktober 2016. Review Intro-1: Frets J. Rieuwpassa (Prodi: Pengolahan hasil perikanan ). Judul :

1 / 14

Télécharger la présentation

Review Introduction

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Review Introduction Talent Scouting untuk PTN BarudanUniversitas di Wilayah Indonesia Timur PoliteknikNegeri Nusa Utara Tahuna, Sangihe, Sulawesi Utara 10-12 Oktober 2016

  2. Review Intro-1: Frets J. Rieuwpassa (Prodi: Pengolahanhasilperikanan) • Judul: • KarakterisasiSifatFungsionalBioaktif-PeptidadariTeripangHasilEkstraksiMenggunakanTeknologiMembranUltrafiltrasi (Characteristic of Functional Properties of Bioactif-Peptide From Sea Cucumber Extration Using MembranUltrafiltration Technology) • Saran/Masukkan • Typo • Hindaripenggunaanistilah yang samaberulang-ulang. Kita dapatmenggunakanistilah lain atau kata pengganti yang maknanyamirip • Sumberreferensiterlalu “tua”: 1993, 1996, 2002, 2003. Gunakanreferensiterkini yang relevansehinggapenelititerlihatmemangmengikutiperkembanganpenelitianbidang yang dikaji • Kutipan: “Hasilpenelitianmembuktikanbahwa…” sebaiknyamenggunakansumberreferensinya, misalkan “Heru (2013) membuktikanbahwa…” • Problem yang akandikaji: • PenggunaanMembranUltrafiltrasi Q: Apakahadapendekatan lain yang dapatAndatelitisebagai novelty? • KarakterisasifungsionaldariekstraksiBioaktif-PeptidaTeripang Apakahbelumada yang menelitihalini?

  3. Review Intro-2: Usy Nora Manurung (Prodi: TeknologiBudidayaIkan) • Judul: • PemberianEkstrakRumputLautpadaIkanNilaOreochromisNilaticusuntukMeningkatkanResistensiTerhadapBakteriAeromonashydrophila • Saran/Masukkan • Typo • Key terms: RumputLaut, IkanNila, Resistensi/Imunologi, BakteriAeromonashydrophila • Why? • What the advantages? What the effect(s) of the bacteria to Nila? • Judulkurang “menjual” (tidakmenarik) • Ada “hilang” koneksi yang menyambungkanantara ”penyakit”, “rumputlaut”, danikanNila • Apakah yang tertulismerupakan ”Introduction”, bagiandari “Metodologi”, ataukajianpeneliti lain (tetapitidakadareferensi)?

  4. Review Intro-3: Gracia Ch. Tooy (Prodi: Keperawatan) • Judul: • DeterminanKinerja Tenaga Kesehatan di Puskesmas Daerah PerbatasandanKepulauan • Saran/Masukkan • Data: Tenaga Kesehatan di Puskesmas 1 dari 4 masalah yang ada • Lokasi: Daerah PerbatasandanKepulauan di Indonesia? • Q: Apakah di negaratujuanstudiada unit kesehatan yang setaraatauseluruh data diambil di Indonesia? Berapa lama? • Dukungdenganriset yang telahdilakukanterkaitfakta-faktamasalah yang ada • Fakta: ”85 orang  D3 = 63 orang, SPK = 22 orang” sebutkansumbernya • Masalahmenjadi “rumit” dan “kompleks”  why? How to measure it?

  5. Review Intro-4: Jaka. F. P. Palawe(Prodi: TeknologiPengolahanIkan) • Judul: • EksplorasiOlisakaridadariHasilLautsebagaiSenyawaPrebiotik • Saran/Masukkan • Key terms: Olisakarida, SenyawaPrebiotik • Q: Why olisakarida? What is/are the advantage(s)? • Hindaripenggunaan kata yang samasecaraberulangdankalimat yang terlalupanjang (kalimatterakhirpadaparagraf 1) • Perhatikanstrukturkalimatkhususnyadalampenggunaankalimatmajemuk • Perludibahaslebihrincihasil/solusidaripenelitiansebelumnya • Belumterlihatmasalahapa yang terjadidalampenelitiandansolusiapa yang akanditawarkan(termasukhipotesisAnda). • DalamtulisanhanyadisampaikanmanfaatprebiotikOligosakarida, namuntidakdisampaikanapa yang Andaingintelititerkait “Eksplorasi”-nya?

  6. Review Intro-5: Stenly C. Takarendehang(Prodi: TeknologiInformatika) • Judul: • Information Technology Infrastructure Security Standard in Rural Archipelago Territorial Area • Saran/Masukkan • Key terms: IT Infrastructure, Security, Rural Area • Q: Why security aspect(s) in IT infrastructure so important? Why rural? Is it different from other type of area? • In statement: “Cost are cheap, No security standard, etc.”  Need: Facts or prior research result(s) • What kind of security standard should we be implemented?  references: research or experience? • Avoid this kind of sentence: “I already read research about security issues from Mr. X.” • Avoid ego-centric pronoun • Is the security awareness in government institution related to “rural area”? • Why don’t you offer such kind of “design, architecture, or protocol of security mechanism/standard” instead of “just offering a security standard”?

  7. Review Intro-6: Stendy B. Sakur(Prodi: TeknikInformatika) • Judul: • Acceleration classify data signal EEG using graphics processing unit (GPU) • Saran/Masukkan • Typo and improve your ”English” writings, but it is good start you wrote it in English (:  Organize your sentence • Key terms: EEG, GPU • Q: Why we need acceleration? How to classify EEG? Why do you need GPU? • You don’t need to write explicitly on the title, just write it in the body of your article as a tool  Intro, Scope, or Methodology • EEG signal or signal EEG? What do you think? (-; • You need to “state” solutions of prior research on similar topics. What problem would you want to solve? • What problem would you want to solve?  EEG with statistical, numerical, GPU, or …? NOT CLEAR

  8. Review Intro-7: Chatrina M. A. Bajak(Prodi: Keperawatan) • Judul: • Evaluation of Clinical Education Environment Related (to?) LearningExperience: To develop more Effective Learning in Clinical Settings • Saran/Masukkan • Evaluation vs. Effective? • Why CEERLE is so important? • Note some prior research results on the introduction: problem solution, limitation, methods, etc. • Improve your “English” writing

  9. Review Intro-8: Edwin O. Langi (Prodi: TeknologiBudidayaIkan) • Judul: • Growth Analysis of Commercial Sea Cucumber Post Mutilation • Saran/Masukkan • Pair: “either … or …”; “neither … nor …” • What problem do you want to solve? • The idea is not clearly stated. • What is the relation between: Commercial, Sea Cucumber, and (Post) Mutilation

  10. Review Intro-9: MeistvinWelembuntu(Prodi: Keperawatan) • Judul: • Peer to Peer Mentoring Program • Saran/Masukkan • (Study, Design) on Peer to Peer Mentoring Program • Use variation of terms or similar meaning of terms, not always use the same. • Hypothesis: one of solution is “peer mentoring program” • 1-group (which is applying peer mentoring program) vs. control group (which is applying traditional model)? • Give your attention on Grammar and Structure • How about your research theme? Qualitative vs. Quantitative Research?

  11. Review Intro-10: Stevy Imelda M. Wodi (Prodi: MikrobiologiPengolahanHasilPerikanan) • Judul: • Studies on The Structural Changes of Myoglobin and Identification of Bacteria Produced Histamine in Big Eye Tuna (Thunnusobesus) • Saran/Masukkan • “Bigeye Tuna (plural?) are important fish species …”  How important is it? • ”Mioglobin was water soluble protein that found in liquid muscle cell was changed to brown”  How many sentence(s)? 1, 2, 3, or more? • How about: • “Mioglobin is water soluble protein founded in liquid muscle cell. It was changed to brown” • “Mioglobin, water soluble protein founded in liquid muscle cell, was changed to brown” • “Mioglobin which is water soluble founded in liquid muscle cell was changed to brown” • Improve your structure • Give your attention to your (main) research problems?

  12. Review Intro-11: DesmiantiBabo(Prodi: TeknologiBudidayaIkan) • Judul: • Nitrogen Fixation and Protein Formation by Azolla Cultured in Different Nutrient Enriched and Influence to Bawal Fish • Saran/Masukkan • “Indonesia is a rich country in natural resources. Azolla is one inside”  give the fact! • How about: “Indonesia has a diversity of natural resources. One of them is Azolla (Heru, 2014).” • There are many ”missing” connection within sentences or paragraph • Problem(s) is/are NOT clearly stated.

  13. Review Intro-12: DarnaSusantie(Prodi: BiologiIkan) • Judul: • Some Aspect Biology Eel in Sangihe Island • Saran/Masukkan • Typo • Improve your English structure! • Why EEL? Why should it be conducted in Sangihe Island? • You stated, “In Sangihe island not yet research about specific species in Sangiheisland. • “Sangihe has a specific species of eel but there is no researcher investigating it.” • Q: What is the difference of Sangihe island? Find the uniqueness of Sangihe’s eel! • Time schedule is not necessary to state on Introduction. You may state it on Time Frame section.

  14. Review Intro-13: AgnetaLalombo(Prodi: Keperawatan) • Judul: • (Studies on) Teacher PerlocutionaryAct and Persuasive Communication at Classroom • Saran/Masukkan • Typo • The use of pronoun: • Avoid the use of pronouns in an academic writing: I, we • Use appropriate pronouns: The authors, The researchers, They • Problem(s) is/are not clearly stated, including the limitation • The example (e.g. “conversation”) should not be put too many on Introduction. Preferable: some results/solutions and methods of prior research

More Related