Download
review introduction n.
Skip this Video
Loading SlideShow in 5 Seconds..
Review Introduction PowerPoint Presentation
Download Presentation
Review Introduction

Review Introduction

463 Views Download Presentation
Download Presentation

Review Introduction

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Review Introduction Talent Scouting untuk PTN BarudanUniversitas di Wilayah Indonesia Timur PoliteknikNegeri Nusa Utara Tahuna, Sangihe, Sulawesi Utara 10-12 Oktober 2016

  2. Review Intro-1: Frets J. Rieuwpassa (Prodi: Pengolahanhasilperikanan) • Judul: • KarakterisasiSifatFungsionalBioaktif-PeptidadariTeripangHasilEkstraksiMenggunakanTeknologiMembranUltrafiltrasi (Characteristic of Functional Properties of Bioactif-Peptide From Sea Cucumber Extration Using MembranUltrafiltration Technology) • Saran/Masukkan • Typo • Hindaripenggunaanistilah yang samaberulang-ulang. Kita dapatmenggunakanistilah lain atau kata pengganti yang maknanyamirip • Sumberreferensiterlalu “tua”: 1993, 1996, 2002, 2003. Gunakanreferensiterkini yang relevansehinggapenelititerlihatmemangmengikutiperkembanganpenelitianbidang yang dikaji • Kutipan: “Hasilpenelitianmembuktikanbahwa…” sebaiknyamenggunakansumberreferensinya, misalkan “Heru (2013) membuktikanbahwa…” • Problem yang akandikaji: • PenggunaanMembranUltrafiltrasi Q: Apakahadapendekatan lain yang dapatAndatelitisebagai novelty? • KarakterisasifungsionaldariekstraksiBioaktif-PeptidaTeripang Apakahbelumada yang menelitihalini?

  3. Review Intro-2: Usy Nora Manurung (Prodi: TeknologiBudidayaIkan) • Judul: • PemberianEkstrakRumputLautpadaIkanNilaOreochromisNilaticusuntukMeningkatkanResistensiTerhadapBakteriAeromonashydrophila • Saran/Masukkan • Typo • Key terms: RumputLaut, IkanNila, Resistensi/Imunologi, BakteriAeromonashydrophila • Why? • What the advantages? What the effect(s) of the bacteria to Nila? • Judulkurang “menjual” (tidakmenarik) • Ada “hilang” koneksi yang menyambungkanantara ”penyakit”, “rumputlaut”, danikanNila • Apakah yang tertulismerupakan ”Introduction”, bagiandari “Metodologi”, ataukajianpeneliti lain (tetapitidakadareferensi)?

  4. Review Intro-3: Gracia Ch. Tooy (Prodi: Keperawatan) • Judul: • DeterminanKinerja Tenaga Kesehatan di Puskesmas Daerah PerbatasandanKepulauan • Saran/Masukkan • Data: Tenaga Kesehatan di Puskesmas 1 dari 4 masalah yang ada • Lokasi: Daerah PerbatasandanKepulauan di Indonesia? • Q: Apakah di negaratujuanstudiada unit kesehatan yang setaraatauseluruh data diambil di Indonesia? Berapa lama? • Dukungdenganriset yang telahdilakukanterkaitfakta-faktamasalah yang ada • Fakta: ”85 orang  D3 = 63 orang, SPK = 22 orang” sebutkansumbernya • Masalahmenjadi “rumit” dan “kompleks”  why? How to measure it?

  5. Review Intro-4: Jaka. F. P. Palawe(Prodi: TeknologiPengolahanIkan) • Judul: • EksplorasiOlisakaridadariHasilLautsebagaiSenyawaPrebiotik • Saran/Masukkan • Key terms: Olisakarida, SenyawaPrebiotik • Q: Why olisakarida? What is/are the advantage(s)? • Hindaripenggunaan kata yang samasecaraberulangdankalimat yang terlalupanjang (kalimatterakhirpadaparagraf 1) • Perhatikanstrukturkalimatkhususnyadalampenggunaankalimatmajemuk • Perludibahaslebihrincihasil/solusidaripenelitiansebelumnya • Belumterlihatmasalahapa yang terjadidalampenelitiandansolusiapa yang akanditawarkan(termasukhipotesisAnda). • DalamtulisanhanyadisampaikanmanfaatprebiotikOligosakarida, namuntidakdisampaikanapa yang Andaingintelititerkait “Eksplorasi”-nya?

  6. Review Intro-5: Stenly C. Takarendehang(Prodi: TeknologiInformatika) • Judul: • Information Technology Infrastructure Security Standard in Rural Archipelago Territorial Area • Saran/Masukkan • Key terms: IT Infrastructure, Security, Rural Area • Q: Why security aspect(s) in IT infrastructure so important? Why rural? Is it different from other type of area? • In statement: “Cost are cheap, No security standard, etc.”  Need: Facts or prior research result(s) • What kind of security standard should we be implemented?  references: research or experience? • Avoid this kind of sentence: “I already read research about security issues from Mr. X.” • Avoid ego-centric pronoun • Is the security awareness in government institution related to “rural area”? • Why don’t you offer such kind of “design, architecture, or protocol of security mechanism/standard” instead of “just offering a security standard”?

  7. Review Intro-6: Stendy B. Sakur(Prodi: TeknikInformatika) • Judul: • Acceleration classify data signal EEG using graphics processing unit (GPU) • Saran/Masukkan • Typo and improve your ”English” writings, but it is good start you wrote it in English (:  Organize your sentence • Key terms: EEG, GPU • Q: Why we need acceleration? How to classify EEG? Why do you need GPU? • You don’t need to write explicitly on the title, just write it in the body of your article as a tool  Intro, Scope, or Methodology • EEG signal or signal EEG? What do you think? (-; • You need to “state” solutions of prior research on similar topics. What problem would you want to solve? • What problem would you want to solve?  EEG with statistical, numerical, GPU, or …? NOT CLEAR

  8. Review Intro-7: Chatrina M. A. Bajak(Prodi: Keperawatan) • Judul: • Evaluation of Clinical Education Environment Related (to?) LearningExperience: To develop more Effective Learning in Clinical Settings • Saran/Masukkan • Evaluation vs. Effective? • Why CEERLE is so important? • Note some prior research results on the introduction: problem solution, limitation, methods, etc. • Improve your “English” writing

  9. Review Intro-8: Edwin O. Langi (Prodi: TeknologiBudidayaIkan) • Judul: • Growth Analysis of Commercial Sea Cucumber Post Mutilation • Saran/Masukkan • Pair: “either … or …”; “neither … nor …” • What problem do you want to solve? • The idea is not clearly stated. • What is the relation between: Commercial, Sea Cucumber, and (Post) Mutilation

  10. Review Intro-9: MeistvinWelembuntu(Prodi: Keperawatan) • Judul: • Peer to Peer Mentoring Program • Saran/Masukkan • (Study, Design) on Peer to Peer Mentoring Program • Use variation of terms or similar meaning of terms, not always use the same. • Hypothesis: one of solution is “peer mentoring program” • 1-group (which is applying peer mentoring program) vs. control group (which is applying traditional model)? • Give your attention on Grammar and Structure • How about your research theme? Qualitative vs. Quantitative Research?

  11. Review Intro-10: Stevy Imelda M. Wodi (Prodi: MikrobiologiPengolahanHasilPerikanan) • Judul: • Studies on The Structural Changes of Myoglobin and Identification of Bacteria Produced Histamine in Big Eye Tuna (Thunnusobesus) • Saran/Masukkan • “Bigeye Tuna (plural?) are important fish species …”  How important is it? • ”Mioglobin was water soluble protein that found in liquid muscle cell was changed to brown”  How many sentence(s)? 1, 2, 3, or more? • How about: • “Mioglobin is water soluble protein founded in liquid muscle cell. It was changed to brown” • “Mioglobin, water soluble protein founded in liquid muscle cell, was changed to brown” • “Mioglobin which is water soluble founded in liquid muscle cell was changed to brown” • Improve your structure • Give your attention to your (main) research problems?

  12. Review Intro-11: DesmiantiBabo(Prodi: TeknologiBudidayaIkan) • Judul: • Nitrogen Fixation and Protein Formation by Azolla Cultured in Different Nutrient Enriched and Influence to Bawal Fish • Saran/Masukkan • “Indonesia is a rich country in natural resources. Azolla is one inside”  give the fact! • How about: “Indonesia has a diversity of natural resources. One of them is Azolla (Heru, 2014).” • There are many ”missing” connection within sentences or paragraph • Problem(s) is/are NOT clearly stated.

  13. Review Intro-12: DarnaSusantie(Prodi: BiologiIkan) • Judul: • Some Aspect Biology Eel in Sangihe Island • Saran/Masukkan • Typo • Improve your English structure! • Why EEL? Why should it be conducted in Sangihe Island? • You stated, “In Sangihe island not yet research about specific species in Sangiheisland. • “Sangihe has a specific species of eel but there is no researcher investigating it.” • Q: What is the difference of Sangihe island? Find the uniqueness of Sangihe’s eel! • Time schedule is not necessary to state on Introduction. You may state it on Time Frame section.

  14. Review Intro-13: AgnetaLalombo(Prodi: Keperawatan) • Judul: • (Studies on) Teacher PerlocutionaryAct and Persuasive Communication at Classroom • Saran/Masukkan • Typo • The use of pronoun: • Avoid the use of pronouns in an academic writing: I, we • Use appropriate pronouns: The authors, The researchers, They • Problem(s) is/are not clearly stated, including the limitation • The example (e.g. “conversation”) should not be put too many on Introduction. Preferable: some results/solutions and methods of prior research