temima
Uploaded by
47 SLIDES
665 VUES
480LIKES

Exploring Helix-Loop-Helix Motifs and Protein Structure Analysis Techniques

DESCRIPTION

The helix-loop-helix (HLH) motif is prominent in DNA binding domains, particularly in homeobox proteins, which are crucial for developmental regulation. This article discusses various protein structure motifs, such as beta-sheets and tertiary structures, and introduces key concepts like protein domains—segments that can fold independently and perform distinct functions. Additionally, we delve into structural comparison methods including RMS superposition and dynamic programming for alignment, highlighting the importance of 3D structural analysis in understanding evolutionary relationships among proteins.

1 / 47

Télécharger la présentation

Exploring Helix-Loop-Helix Motifs and Protein Structure Analysis Techniques

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Another example of the helix-loop-helix motif is seen within several DNA binding domains including the homeobox proteins which are the master regulators of development Modules HMMs, Profiles, Motifs, and Multiple Alignments used to define modules (Figures from Branden & Tooze) • Several motifs (b-sheet, beta-alpha-beta, helix-loop-helix) combine to form a compact globular structure termed a domain or tertiary structure • A domain is defined as a polypeptide chain or part of a chain that can independently fold into a stable tertiary structure • Domains are also units of function (DNA binding domain, antigen binding domain, ATPase domain, etc.)

  2. COG 272, BRCT family P. Bork et al

  3. Five Principal Fold Classes All a folds All b folds a + b folds a / b folds small irregular folds

  4. SCOP - Protein Fold Hierarchy Class - 5 Fold - ~500 Superfamily - ~ 700 Family ~ 1000 Family - domains with common evolutionary origin

  5. } “Twilight zone” Sequence Similarity May Miss Functional Homologies Which Can Be Detected by3D Structural Analysis Homologous 3D Structure Non-homologous 3D Structure % Sequence Identity Residues Aligned Adapted from Chris Sander

  6. Structural Validation of Homology 19% Seq ID Z = 12.2 Adenylate Kinase Guanylate Kinase

  7. Asp tRNA Synthetase Staphylococcal Nuclease CspA Gene 5 ssDNA Binding Protein Topoisomerase I CspB

  8. What is Protein Geometry? • Coordinates (X, Y, Z’s) • Dihedral Angles • Assumes standard bond lengths and bond angles

  9. Atom Position, XYZ triplets Other Aspects of Structure, Besides just Comparing Atom Positions Lines, Axes, Angles Surfaces, Volumes

  10. Depicting Protein Structure:Sperm Whale Myoglobin

  11. Sperm Whale Myoglobin

  12. Structural Alignment of Two Globins

  13. Hb Automatic Alignment to Build Fold Library Alignment of Individual Structures Fusing into a Single Fold “Template” Mb Hb VLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHF-DLS-----HGSAQVKGHGKKVADALTNAV ||| .. | |.|| | . | . | | | | | | | .| .| || | || . Mb VLSEGEWQLVLHVWAKVEADVAGHGQDILIRLFKSHPETLEKFDRFKHLKTEAEMKASEDLKKHGVTVLTALGAIL Hb AHVD-DMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR------ | | . || | .. . .| .. | |..| . . | | . ||. Mb KK-KGHHEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRHPGDFGADAQGAMNKALELFRKDIAAKYKELGYQG Elements: Domain definitions; Aligned structures, collecting together Non-homologous Sequences; Core annotation Previous work: Remington, Matthews ‘80; Taylor, Orengo ‘89, ‘94; Artymiuk, Rice, Willett ‘89; Sali, Blundell, ‘90; Vriend, Sander ‘91; Russell, Barton ‘92; Holm, Sander ‘93; Godzik, Skolnick ‘94; Gibrat, Madej, Bryant ‘96; Falicov, F Cohen, ‘96; Feng, Sippl ‘96; G Cohen ‘97; Singh & Brutlag, ‘98

  14. Explain Concept of Distance Matrix on Blackboard N x N distance matrix N dimensional space Metric matrix Mij = Dij2 - Dio2 - Djo2 Eigenvectors of metric matrix Principal component analysis

  15. Automatically Comparing Protein Structures Given 2 Structures (A & B), 2 Basic Comparison Operations 1 Given an alignment optimally SUPERIMPOSE A onto B Find Best R & T to move A onto B 2 Find an Alignment between A and B based on their 3D coordinates

  16. RMS Superposition (1) B A

  17. RMS Superposition (2):Distance Betweenan Atom in 2 Structures

  18. RMS Superposition (3):RMS Distance BetweenAligned Atoms in 2 Structures

  19. RMS Superposition (4):Rigid-Body Rotation and Translationof One Structure (B)

  20. RMS Superposition (5):Optimal Movement of One Structure to Minimize the RMS Methods of Solution: springs(F ~ kx) SVD Kabsch

  21. Alignment (1) Make a Similarity Matrix(Like Dot Plot)

  22. Structural Alignment (1b) Make a Similarity Matrix(Generalized Similarity Matrix) • PAM(A,V) = 0.5 • Applies at every position • S(aa @ i, aa @ J) • Specific Matrix for each pair of residues i in protein 1 and J in protein 2 • Example is Y near N-term. matches any C-term. residue (Y at J=2) • S(i,J) • Doesn’t need to depend on a.a. identities at all! • Just need to make up a score for matching residue i in protein 1 with residue J in protein 2 i J

  23. Seq. Alignment, Struc. Alignment, Threading

  24. Structural Alignment (1c*)Similarity Matrixfor Structural Alignment • Structural Alignment • Similarity Matrix S(i,J) depends on the 3D coordinates of residues i and J • Distance between CA of i and J • M(i,j) = 100 / (5 + d2) • Threading • S(i,J) depends on the how well the amino acid at position i in protein 1 fits into the 3D structural environment at position J of protein 2

  25. Alignment (2): Dynamic Programming,Start Computing the Sum Matrix new_value_cell(R,C) <= cell(R,C) { Old value, either 1 or 0 } + Max[ cell (R+1, C+1), { Diagonally Down, no gaps } cells(R+1, C+2 to C_max),{ Down a row, making col. gap } cells(R+2 to R_max, C+2) { Down a col., making row gap } ]

  26. Alignment (3):Dynamic Programming, Keep Going

  27. Alignment (4): Dynamic Programming, Sum Matrix All Done

  28. Alignment (5): Traceback Find Best Score (8) and Trace BackA B C N Y - R Q C L C R - P MA Y C - Y N R - C K C R B P

  29. ACSQRP--LRV-SH -R SENCVA-SNKPQLVKLMTH VK DFCV- In Structural Alignment, Not Yet Done (Step 6*) • Use Alignment to LSQ Fit Structure B onto Structure A • However, movement of B will now change the Similarity Matrix • This Violates Fundamental Premise of Dynamic Programming • Way Residue at i is aligned can now affect previously optimal alignment of residues(from 1 to i-1)

  30. How central idea of dynamic programming is violated in structural alignment

  31. Structural Alignment (7*), Iterate Until Convergence 1 Compute Sim. Matrix 2 Align via Dyn. Prog. 3 RMS Fit Based on Alignment 4 Move Structure B 5 Re-compute Sim. Matrix 6 If changed from #1, GOTO #2

  32. Some Similarities are Readily Apparent others are more Subtle Easy:Globins 125 res., ~1.5 Å Tricky:Ig C & V 85 res., ~3 Å Very Subtle: G3P-dehydro-genase, C-term. Domain >5 Å

  33. Some Similarities are Readily Apparent others are more Subtle Easy:Globins 125 res., ~1.5 Å Tricky:Ig C & V 85 res., ~3 Å Very Subtle: G3P-dehydro-genase, C-term. Domain >5 Å

  34. DALI: Protein Structure Comparison by Alignment of Distance MatricesL. Holm and C. Sander J. Mol. Biol. 233: 123 (1993) • Generate Ca-Ca distance matrix for each protein A and B • Decompose into elementary contact patterns; e.g. hexapeptide-hexapeptide submatrices • Systematic comparisons of all elementary contact patterns in the 2 distance matrices; similar contact patterns are stored in a “pair list” • Assemble pairs of contact patterns into larger consistent sets of pairs (alignments), maximizing the similarity score between these local structures • A Monte-Carlo algorithm is used to deal with the combinatorial complexity of building up alignments from contact patterns • Dali Z score - number of standard deviations away from mean pairwise similarity value

  35. Structural Validation of Homology 19% Seq ID Z = 12.2 Adenylate Kinase Guanylate Kinase

  36. Dali Domain DictionaryDeitman, Park, Notredame, Heger, Lappe, and Holm Nucleic Acids Res. 29: 5557 (2001) • Dali Domain Dictionary is a numerical taxonomy of all known domain structures in the PDB • Evolves from Dali / FSSP Database Holm & Sander, Nucl. Acid Res. 25: 231-234 (1997) • Dali Domain Dictionary Sept 2000 • 10,532 PDB enteries • 17,101 protein chains • 5 supersecondary structure motifs (attractors) • 1375 fold types • 2582 functional families • 3724 domain sequence families

  37. courtesy of C. Chothia

  38. Most proteins in biology have been produced by the duplication, divergence and recombination of the members of a small number of protein families. courtesy of C. Chothia

  39. courtesy of C. Chothia

  40. courtesy of C. Chothia

  41. courtesy of C. Chothia

  42. courtesy of C. Chothia

  43. Cadherins courtesy of C. Chothia

  44. courtesy of C. Chothia

  45. courtesy of C. Chothia

  46. A Global Representation of Protein Fold SpaceHou, Sims, Zhang, Kim, PNAS 100: 2386 - 2390 (2003) Database of 498 SCOP “Folds” or “Superfamilies” The overall pair-wise comparisons of 498 folds lead to a 498 x 498 matrix of similarity scores Sijs, where Sij is the alignment score between the ith and jth folds. An appropriate method for handling such data matrices as a whole is metric matrix distance geometry . We first convert the similarity score matrix [Sij] to a distance matrix [Dij] by using Dij = Smax - Sij, where Smax is the maximum similarity score among all pairs of folds. We then transform the distance matrix to a metric (or Gram) matrix [Mij] by using Mij = Dij2 - Dio2 - Djo2 where Di0, the distance between the ith fold and the geometric centroid of all N = 498 folds. The eigen values of the metric matrix define an orthogonal system of axes, called factors. These axes pass through the geometric centroid of the points representing all observed folds and correspond to a decreasing order of the amount of information each factor represents.

  47. A Global Representation of Protein Fold SpaceHou, Sims, Zhang, Kim, PNAS 100: 2386 - 2390 (2003)

More Related