1 / 30

Sequence Analysis

Sequence Analysis. Hemant Kelkar Center for Bioinformatics University of North Carolina Chapel Hill, NC 27599. Scope of Series. Talk I Overview and BLAST Talk II Protein analysis/Sequence Alignment Talk III Evolution Genomics and challenges. Bioinformatics.

theo
Télécharger la présentation

Sequence Analysis

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Sequence Analysis Hemant Kelkar Center for Bioinformatics University of North Carolina Chapel Hill, NC 27599

  2. Scope of Series Talk I • Overview and BLAST Talk II • Protein analysis/Sequence Alignment Talk III • Evolution • Genomics and challenges

  3. Bioinformatics • Mathematical, Statistical and computational methods that are used for solving biological problems • Glue that holds the “omics” data together

  4. Help … • Is “my sequence” in the databases? • Is it similar to any sequence in the DB? • Does it have any know motifs/domains that can help in identification? • Is there a structural homolog? • Are there any polymorphisms? • Genetic Map location? Bioinformatics TOOLS!

  5. Bioinformatics Tools • Genetic Code • Similarity search e.g. BLAST, FASTA • Protein Structure • http://restools.sdsc.edu/biotools/biotools9.html • Protein Evolution • e.g. CLUSTALW, T-COFFEE, Phylip

  6. Primary Sequence Databases • GenBank (http://www.ncbi.nlm.nih.gov/Genbank/index.html) • PIR (http://pir.georgetown.edu/) • Swiss-Prot (http://us.expasy.org/sprot/) Sequence information as is generated in the laboratory

  7. Derived Sequence Databases Databases based on functional or phylogenetic analysis • PFAM (http://www.sanger.ac.uk/Software/Pfam/) : Protein families based on HMM models • InterPRO (http://www.ebi.ac.uk/interpro/) : Protein families and domains based on functional sites • TransFac (http://www.gene-regulation.com/) transcription factor db • Cytochrome P450 database (http://drnelson.utmem.edu/CytochromeP450.html)

  8. Derived Sequence Databases Databases based on taxonomy • Flybase (http://www.flybase.org/) : Fly Genome • Wormbase (http://www.wormbase.org/) : C. elegans • Genome Browser (http://genome.ucsc.edu/) : Human and Mouse • MGI (http://www.informatics.jax.org/) : Mouse • Microbial Genome Resource : (http://www.tigr.org/tigr-scripts/CMR2/CMRHomePage.spl)

  9. Sequence Alignments • Provide a measure of relation between the nucleotide or protein sequence • This allows us to decipher: • Structural relationships • Functional relationships • Evolutionary relationships

  10. Sequence Similarity Searches • Information conserved evolutionarily • DNA sequences NOT coding for proteins/rRNAs diverge rapidly • When possible use protein sequences for similarity searches • Non-homologous protein identification is much less reliable • What is measured and what is inferred?

  11. Similarity • Is always based on an observable • Usually expressed as % identity • Quantifies the divergence of two sequences • substitutions/insertions/deletions • Residues crucial for structure and/or function

  12. Homology • Homology always implies that the molecules share a common ancestor • Absolute answer • Molecules ARE or ARE NOT homologous • No degrees

  13. How to Find Similar Sequences • Global Sequence Alignments • Sequence comparison along entire length • Homolog of similar length • Local Sequence Alignments • Similar regions in two sequences • Regions outside the local alignment excluded • Sequences of different length/similarity

  14. Dotplot

  15. Scoring Matrices • Empirical weighting schemes • Considers important biology • Side chain chemistry/structure/function • Functional/Structural Conservation • Ile/Val – small and hydrophobic • Ser/Thr – both polar • Size/Charge/Hydrophibicity

  16. Nucleotide Matrix A C G T A 5 -4 -4 -4 C -4 5 -4 -4 G -4 -4 5 -4 T -4 -4 -4 5

  17. PAM Scoring Matrices • Margaret Dayhoff (1978) • Point accepted mutations (PAM) • Patterns of substitutions in highly related proteins (>85% identical), based on multiple sequence alignments • New side chains must function similarly • 1 PAM  1 AA change per 100 AA • 1 PAM ~ 1 % Divergence

  18. BLOSUM Matrices • Henikoff and Henikoff (1992) • Blocks Substitution Matrices • Differences in conserved ungapped regions • Directly calculated no extrapolations • Sensitive to structural/functional subs • Generally perform better for local similarity searches

  19. Scoring Matrix – BLOSUM62

  20. BLOSUM n • Calculated from sequences sharing no more than n% identity • Sequences with more than n% identity are clustered and weighted to 1 • Reducing the value of “n” yields more divergent/distantly-related sequences • BLOSUM62 used as default by many of the online search sites

  21. Matrices and more PAM Matrices (Altschul, 1991) PAM 40 Short alignments >70% PAM120 >50% PAM250 Longer weaker local areas >30% BLOSUM Matrices (Henikoff, 1993) BLOSUM 90 Short alignments >60% BLOSUM 80 >50% BLOSUM 62 Commonly used >35% BLOSUM 30 Longer, weaker local alignments

  22. Gaps • Compensate for insertion and deletions • Improvement alignments • Must be kept to a reasonably small number • 1 per 20 residues is logical • Need a different scoring scheme

  23. Gap Penalties • Penalty for gap introduction • Penalty for Gap extension Deductions for Gap = G + Ln Nuc Prot where G = gap-opening penalty 5 11 L = Gap-extension penalty 2 1 n = Length of gap

  24. BLAST • Basic Local Alignment Search Tool • Seeks high-scoring segment pair (HSP) • Sequences that can be aligned w/o gaps • have a maximal aggregate score • score be above score threshold S • Many HSP reported for ungapped blast

  25. BLAST Algorithms Program Query Target BLASTN Nucloetide Nucleotide BLASTP Protein Protein BLASTX Nucleotide Protein (6-Frame) TBLASTN Protein Nucleotide (6FR) TBLASTX Nucloetide(6FR) Nucloetide(6FR)

  26. STL 13 SAL 8 SNL 8 SVL 8 SBL 7 SCL 7 SDL 7 Etc. = 4 + 5 + 4 Neighborhood Words Query Word (W = 3) Query: SISPGQRVGLLGRTGSGKSTLLSAFLRMLN-IKGDIE Neighborhood Score Threshold (T = 8)

  27. Query: SISPGQRVGLLGRTGSGKSTLLSAFLRMLN-IKGDIE ++ G + ++G G+GKS+LLSA L L+ ++G + Sbjct: TVPQGCLLAVVGPVGAGKSSLLSALLGELSKVEGFVS High-Scoring Segment Pairs STL 13 SAL 8 SNL 8 SVL 8 SBL 7 SCL 7 SDL 7 Etc.

  28. X Cumulative Score S T Query: SISPGQRVGLLGRTGSGKSTLLSAFLRMLN-IKGDIE Extension ++ G + ++G G+GKS+LLSA L L+ ++G + Sbjct: TVPQGCLLAVVGPVGAGKSSLLSALLGELSKVEGFVS Extension • Significance Decay • Mismatches • Gap penalties

  29. Karlin Altschul Equation E = kmNe-λs m Number of letters in query N Number of letters in db mN Size of search space λs Normalized score k minor constant

  30. http://www.ncbi.nlm.nih.gov

More Related