1 / 2

adam17 antibody

Mouse Anti-ADAM17 Monoclonal Antibody.<br><br>https://www.creative-diagnostics.com/ADAM17-antibody-59613-144.htm<br>

creatived11
Télécharger la présentation

adam17 antibody

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Anti-ADAM17 monoclonal antibody, clone 2G7 Anti-ADAM17 monoclonal antibody, clone 2G7 (DMABT-H12989) (DMABT-H12989) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Product Overview Product Overview Mouse Anti-ADAM17 Monoclonal Antibody Target Target ADAM17 Immunogen Immunogen ADAM17 (NP_003174, 215 a.a. ~ 314 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype Isotype IgG2b Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Clone Clone 2G7 Conjugate Conjugate Unconjugated Applications Applications WB, IHC, sELISA, ELISA Sequence Similarities Sequence Similarities RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTSWDNAGFKGYGIQI EQIRILKSPQ EVKPGEKHYNMAKSYPNEEKDAWDV Size Size 1 ea Buffer Buffer In 1x PBS, pH 7.2 Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION GENE INFORMATION Gene Name Gene Name ADAM17 ADAM metallopeptidase domain 17 [ Homo sapiens ] Official Symbol Official Symbol ADAM17 Synonyms Synonyms ADAM17; ADAM metallopeptidase domain 17; TACE, tumor necrosis factor, alpha, converting enzyme; disintegrin and metalloproteinase domain-containing protein 17; CD156B; cSVP; TNF- alpha convertase; snake venom-like protease; TNF-alpha converting enzyme; ADAM metallopeptidase domain 18; tumor necrosis factor, alpha, converting enzyme; CSVP; TACE; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved

  2. NISBD; ADAM18; Entrez Gene ID Entrez Gene ID 6868 mRNA Refseq mRNA Refseq NM_003183 Protein Refseq Protein Refseq NP_003174 MIM MIM 603639 UniProt ID UniProt ID B2RNB2 Chromosome Location Chromosome Location 2p25 Pathway Pathway Activated NOTCH1 Transmits Signal to the Nucleus, organism-specific biosystem; Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Cytokine Signaling in Immune system, organism-specific biosystem; Delta-Notch Signaling Pathway, organism-specific biosystem; Disease, organism-specific biosystem; Epithelial cell signaling in Helicobacter pylori infection, organism-specific biosystem; Function Function PDZ domain binding; SH3 domain binding; integrin binding; interleukin-6 receptor binding; metal ion binding; metalloendopeptidase activity; metalloendopeptidase activity; metallopeptidase activity; metallopeptidase activity; metallopeptidase activity; peptidase activity; protein binding; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved

More Related