20 likes | 23 Vues
Anti-ADAM33 polyclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/Anti-ADAM33-PAb-191499-147.htm<br>
E N D
Anti-ADAM33 (aa 551-650) polyclonal antibody Anti-ADAM33 (aa 551-650) polyclonal antibody (DPAB-DC3319) (DPAB-DC3319) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Antigen Description Antigen Description This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This protein is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness. Alternative splicing results in multiple transcript variants encoding different isoforms. Immunogen Immunogen ADAM33 (NP_079496, 551 a.a. ~ 650 a.a) partial recombinant protein with GST tag. The sequence is AHGNCGQDSEGHFLPCAGRDALCGKLQCQGGKPSLLAPHMVPVDSTVHLDGQEVTCRGALAL PSAQLDLLGLGLVEPGTQCGPRMVCQSRRCRKNAFQEL Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Conjugate Conjugate Unconjugated Applications Applications WB (Recombinant protein), ELISA, Size Size 50 μl Buffer Buffer 50 % glycerol Preservative Preservative None Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION GENE INFORMATION Gene Name Gene Name ADAM33 ADAM metallopeptidase domain 33 [ Homo sapiens (human) ] Official Symbol Official Symbol ADAM33 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved
Synonyms Synonyms ADAM33; ADAM metallopeptidase domain 33; C20orf153; DJ964F7.1; disintegrin and metalloproteinase domain-containing protein 33; ADAM 33; a disintegrin and metalloprotease 33; a disintegrin and metalloproteinase domain 33; disintegrin and reprolysin metalloproteinase family protein; Entrez Gene ID Entrez Gene ID 80332 Protein Refseq Protein Refseq NP_001269376 UniProt ID UniProt ID A2A2L3 Chromosome Location Chromosome Location 20p13 Function Function metalloendopeptidase activity; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved