20 likes | 21 Vues
Anti-ADAMTS17 polyclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/Anti-ADAMTS17-PAb-188926-147.htm<br>
E N D
Anti-ADAMTS17 (aa 543-650) polyclonal antibody Anti-ADAMTS17 (aa 543-650) polyclonal antibody (DPAB-DC746) (DPAB-DC746) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Antigen Description Antigen Description This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by ADAMTS19, another family member. The function of this protein has not been determined. Immunogen Immunogen ADAMTS17 (NP_620688, 543 a.a. ~ 650 a.a) partial recombinant protein with GST tag. The sequence is DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLP SFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human Conjugate Conjugate Unconjugated Applications Applications WB (Recombinant protein), ELISA, Size Size 50 μl Buffer Buffer 50 % glycerol Preservative Preservative None Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. GENE INFORMATION GENE INFORMATION Gene Name Gene Name ADAMTS17 ADAM metallopeptidase with thrombospondin type 1 motif, 17 [ Homo sapiens (human) ] Official Symbol Official Symbol ADAMTS17 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved
Synonyms Synonyms ADAMTS17; ADAM metallopeptidase with thrombospondin type 1 motif, 17; A disintegrin and metalloproteinase with thrombospondin motifs 17; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17; Entrez Gene ID Entrez Gene ID 170691 Protein Refseq Protein Refseq NP_620688 UniProt ID UniProt ID Q8TE56 Chromosome Location Chromosome Location 15q24 Pathway Pathway Metabolism of proteins; O-linked glycosylation; Function Function metalloendopeptidase activity; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved