Supplemental Fig. 1

Nov 19, 2014

20 likes | 91 Vues

Supplemental Fig. 1. Supplemental Fig. 2.

Share Presentation

Embed Code

Link

supplemental fig

ignatius-kerr

Télécharger la présentation

Supplemental Fig. 1

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Supplemental Fig. 1
Supplemental Fig. 2

Supplemental data Fig. S1

Supplemental data Fig. S1.

148 views • 4 slides

Supplemental Fig. 4

Supplemental Fig. 4. p= 9.5 x10 -3. p= 2.0 x10 -8. Group 3 Group 4 SHH WNT. Group 3 Group 4 SHH WNT. p= 0.0027. Group 3 Group 4 SHH WNT. Supplemental Fig. 5. Supplemental Fig. 6. C. B. A.

108 views • 3 slides

Supplemental Fig. 1

Supplemental Fig. 1. p= 0.036. p= 0.29. p= 0.30. p= 0.77. Supplemental Fig. 2. p= 1.8 x10 -10. p= 6.9 x10 -9. Group 3 Group 4 SHH WNT. Group 3 Group 4 SHH WNT. p= 6.58 x 10 -6. p= 0.0002.

113 views • 3 slides

Supplemental Fig 2

Supplemental Fig 2 . A. B. C. R 2. %CV. Peptide number. Peptide number. Comparison of the coefficient of variation between TIQUAS and MRM. .

92 views • 1 slides

Supplemental Fig. S1

extracellular (P=0.000) cell wall (P=0.000) ribosome (P=0.001) ER (P=0.294) golgi apparatus (P=0.005) plasma membrane (P=0.000) mitochondria (P=0.000) cytosol (P=0.553) other cellular components (P=0.000) nucleus (P=0.000) other membranes (P=0.970) plastid (P=0.000)

264 views • 12 slides

Supplemental Fig. 2.

95 views • 1 slides

Supplemental Fig. S1

Supplemental Fig. S1. a). b). PsAPY1 (AB071369) 1:MEFLIKLIT-FLLFSMPAITSSQYLGNNLLTSRKIFLKQEEISSYAVVFDAGSTGSRIHV 59 MtAPY1;1 (AY180377) 1:MEFLITLITTVLLLLMPAITSSQYLGNNLLTNRKIFQKQETISSYAVVFDAGSTGSRIHV 60 ***** *** ** **************** **** *** *******************

121 views • 3 slides

Supplemental FIG. S1

Supplemental FIG. S1. 1387 CAGUGCUUUAACUCUGUGCA UCACACUUGUCCUUUAAAUG 1427 GAGACUGUAAGCUUUUAUGA ACUUUUUUUACUUGGACACC 1467 ACUUUUACACAAAGUAUUUU GAAACAAAAGGCUAUAGGAA 1507 ACAUGAAAAGGUCAAAUGAU CAUUAUGCUGCUAUGGAGGA 1547 UGCUACUUGAUGGAGAUCAG CUGCUCGGGGCCAAGAAAAA

91 views • 1 slides

Supplemental Fig.7

MoL #33472. Supplemental Fig.7. A B. C C.

64 views • 1 slides

Supplemental Fig. 3

Supplemental Fig. 3.

87 views • 1 slides

Supplemental Fig.4

MoL #33472. Supplemental Fig.4. A B.

94 views • 1 slides

Supplemental Fig. 1

Supplemental Figure 1. Alignment of CALTPI and CALTPII proteins residues with tobacco lipid transfer protein1 (accession no. D13952).

133 views • 1 slides

Supplemental Fig. 1

116 views • 5 slides

Supplemental Fig. 2

Supplemental Fig. 2. a. 32Dp210. 32DP210. f. 32Dp210. g. 32Dp210. WP1193 ( m M) C 0.5 1.0 2.0 3.0 4.0. e. 32DP210. c. d. K562-R. C 15 30 45 60 (min).

97 views • 1 slides

Supplemental Fig.3

A B C. D E F. MoL #33472. Supplemental Fig.3.

96 views • 1 slides

Supplemental Fig.6

MoL #33472. Supplemental Fig.6. A B. C D.

74 views • 1 slides

Supplemental Fig. 2

Fabio Arturo Iannotti, Elisabetta Panza, Vincenzo Barrese, Davide Viggiano, Maria Virginia Soldovieri, and Maurizio Taglialatela. Expression, Localization, And Pharmacological Role Of Kv7 Potassium Channels In Skeletal Muscle Proliferation, Differentiation And Survival After Myotoxic Insults .

130 views • 1 slides

Supplemental Fig. 1

Supplemental Fig. 1. T-cell proliferation (cps 3 H thymidine). condition A - control. condition D - DCs pre-incubated in lenalidomide. condition C - T-cells pre-incubated in lenalidomide. condition B - lenalidomide present during co-culture. 1:10. 1:30. 1:100. 1:300. 1:1000.

169 views • 2 slides

Supplemental figures Fig S1

Supplemental figures Fig S1. Fig S2.

145 views • 1 slides

Supplemental Fig. 1

Supplemental Fig. 1 Live and dead cells estimated by trypan blue cell viability assay in 6-well plates. A. Experiment 1. A’. Experiment 2. d8. d6. d7. d4. d8. d1. d4. d2. d3. Live cells number (x10000). Live cells number (x10000). d1. *. *. *. *. *. *. *. *.

123 views • 1 slides

Supplemental Fig. 1a

Supplemental Fig. 1a. UR. PR. R. FR. 9. 8. 7. 6. 5. 4. 3. 2. 1. 0. 10. Chemical shift (ppm). Supplemental Fig. 1b. UR. PR. R. FR. 9. 8. 7. 6. 5. 4. 3. 2. 1. 0. 10. Chemical shift (ppm). Supplemental Fig. 1c. UR. PR. R. FR. 9. 0. 8. 7. 6. 5.

160 views • 6 slides

Supplemental Fig.2

FNDC5. Absorption control. Gastrocnemius skeletal muscle. Subcutaneous w hite adipose tissue.

95 views • 1 slides

More Related