jerod
Uploaded by
72 SLIDES
1586 VUES
820LIKES

Proteins: Function & Structure

DESCRIPTION

Proteins: Function & Structure. Proteins. Cellular Overview Functions Key Properties Core Topics Amino Acids: properties, classifications, pI Primary Structure, Secondary Structure, and Motifs Tertiary Structure Fibrous vs. Globular Quaternary Structure. Amazing Proteins: Function.

1 / 72

Download Presentation
Télécharger la présentation

Proteins: Function & Structure

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Proteins: Function & Structure

  2. Proteins • Cellular Overview • Functions • Key Properties • Core Topics • Amino Acids: properties, classifications, pI • Primary Structure, Secondary Structure, and Motifs • Tertiary Structure • Fibrous vs. Globular • Quaternary Structure

  3. Amazing Proteins: Function • The largest class of proteins, accelerate rates of reactions • Catalysts (Enzymes) • Transport & Storage DNA Polymerase CK2 Kinase Catalase Ovalbumin Casein Ion channels Hemoglobin Serum albumin

  4. Amazing Proteins: Function • Structural • Generate Movement Collagen Keratin Silk Fibroin Actin Myosin

  5. Amazing Proteins: Function • Regulation of Metabolism and Gene Expression • Protection Lac repressor Insulin Thrombin and Fibrinogen Ricin Venom Proteins Immunoglobulins

  6. Amazing Proteins: Function • Signaling and response (inter and intracellular) Apoptosis Membrane proteins Signal transduction

  7. Amazing Proteins: Properties • Biopolymers of amino acids • Contains a wide range of functional groups • Can interact with other proteins or other biological macromolecules to form complex assemblies • Some are rigid while others display limited flexibility

  8. a-Amino Acids: Protein Building Blocks R-group or side-chain a-amino group Carboxyl group a-carbon

  9. Amino acids are zwitterionic • “Zwitter” = “hybrid” in German • Fully protonated forms will have specific pKa’s for the different ionizable protons • Amino acids are amphoteric (both acid and base)

  10. Stereochemistry of amino acids

  11. Stereochemistry of amino acids (AA) • AA’s synthesized in the lab are racemic mixtures. AA’s from nature are “L” isomers • These are all optically-active except for glycine (why?)

  12. Synthesis of Proteins + H2O

  13. Synthesis of Proteins

  14. N-Terminal End C-Terminal End Synthesis of Proteins

  15. Synthesis of Proteins = ≠

  16. Synthesis of Proteins = ≠

  17. Synthesis of Proteins ≠ ≠

  18. 20 common amino acids make up the multitude of proteins we know of COMMON AMINO ACIDS

  19. Amino Acids With Aliphatic Side Chains

  20. Amino Acids With Aliphatic Side Chains

  21. Amino Acids With Aliphatic Side Chains

  22. Amino Acids With Aromatic Side Chains

  23. Amino Acids with Aromatic Side Chains Can Be Analyzed by UV Spectroscopy

  24. Amino Acids With Hydroxyl Side Chains

  25. Amino Acid with a Sulfhydryl Side Chain

  26. Disulfide Bond Formation

  27. Amino Acids With Basic Side Chains

  28. Amino Acids With Acidic Side Chains and Their Amide Derivatives

  29. There are some important uncommon amino acids

  30. pH and Amino Acids Net charge: +1 Net charge: -1 Net charge: 0

  31. Basic amino acids High pKa Function as bases at physiological pH Side chains with N Acidic amino acids Low pKa Negatively charged at physiological pH Side chains with –COOH Predominantly in unprotonated form Characteristics of Acidic and Basic Amino Acids

  32. Isoelectic point (pI) • the pH at which the compound is electrically neutral • Equal number of (+) and (-) charge • At pH < pI amino acid is (+) • At pH > pI amino acid is (-) • CRITICAL FOR: protein analysis, purification, isolation, crystallization

  33. Protein Structure We use different “levels” to fully describe the structure of a protein.

  34. Primary Structure • Amino acid sequence • Standard: Left to Right means N to C-terminal • Eg. Insulin (AAA40590) • The info needed for further folding is contained in the 1o structure. MAPWMHLLTVLALLALWGPNSVQAYSSQHLCGSNLVEALYMTCGRSGFYRPHDRRELEDLQVEQAELGLEAGGLQPSALEMILQKRGIVDQCCNNICTFNQLQNYCNVP

  35. Secondary Structure • The regular local structure based on the hydrogen bonding pattern of the polypeptide backbone • α helices • β strands (β sheets) • Turns and Loops • WHY will there be localized folding and twisting? Are all conformations possible?

  36. Consequences of the Amide Plane Two degrees of freedom per residue for the peptide chain • Angle about the C(alpha)-N bond is denoted phi • Angle about the C(alpha)-C bond is denoted psi • The entire path of the peptide backbone is known if all phi and psi angles are specified • Some values of phi and psi are more likely than others.

  37. The angles phi and psi are shown here See blackboard for explanation why the peptide bond is planar

  38. Unfavorable orbital overlap precludes some combinations of phi and psi • phi = 0, psi = 180 is unfavorable • phi = 180, psi = 0 is unfavorable • phi = 0, psi = 0 is unfavorable

  39. Steric Constraints on phi & psi Sasisekharan • G. N. Ramachandran was the first to demonstrate the convenience of plotting phi,psi combinations from known protein structures • The sterically favorable combinations are the basis for preferred secondary structures

  40. α Helix • First proposed by Linus Pauling and Robert Corey in 1951. • 3.6 residues per turn, 1.5 Angstroms rise per residue • Residues face outward

  41. α Helix • α-helix is stabilized by H-bonding between CO and NH groups • Except for amino acid residues at the end of the α-helix, all main chain CO and NH are H-bonded

  42. α Helix representation

  43. β strand • Fully extended • β sheets are formed by linking 2 or more strands by H-bonding • Beta-sheet also proposed by Corey and Pauling in 1951.

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer