kiora
Uploaded by
45 SLIDES
1032 VUES
460LIKES

Phylogeny

DESCRIPTION

Phylogeny. - A brief introduction in 4 hours -. Outline. Introduction Practical approach Evolutionary models Distance-based methods / TP5_1 Databases and software Sequence-based methods / TP5_2. What is p hylogeny?. P hylogeny is the evolutionary history and relationship of species. .

1 / 45

Télécharger la présentation

Phylogeny

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Playing audio...

  1. Phylogeny - A brief introduction in 4 hours -

  2. Outline • Introduction • Practical approach • Evolutionary models • Distance-based methods / TP5_1 • Databases and software • Sequence-based methods / TP5_2

  3. What is phylogeny?

  4. Phylogeny is the evolutionary history and relationship of species.

  5. Why is phylogeny of interest in a proteomics course?

  6. What data types can be used to infer phylogenies? • Morphological characters • Physiological characters • Gene order (e.g. in mitochondria) • Sequence data • Nucleotide sequences • Amino acid sequences • Mixed characters • ….

  7. What is a phylogenetic tree? • A phylogenetic tree is a model about the evolutionary relationship between species (OTUs) based on homologous characters • But not all trees are phylogenetic trees • Dendrogram = general term for a branching diagram • Cladogram: branching diagram without branch length estimates • Phylogenetic tree or Phylogram: branching diagram with branch length estimates

  8. What is a phylogenetic tree? • Rooted or unrooted • bifurcating or multifurcating (solved or unsolved)

  9. Gene duplication • Prokaryots: at least 50% • Eukaryots: >90%

  10. After gene duplication • Coexistence (normally only for a short while) • Mostly, only one copy is retained • becomes nonfunctional (non-functionalization), • becomes a pseudogene (pseudogenization) • is lost • Both copies are retained • Distinct expression pattern • Distinct subcellular location (rare) • One copy keeps the original function, the other copy acquires a new function (neofunctionalization) • Deleterious mutations in both entries (subfunctionalization)

  11. Relationships within homologs Frog gene A Orthologs Human gene A Mouse gene A Gene duplication Paralogs Mouse gene B Homologs Ancestral gene Human gene B Orthologs Frog gene B Drosophila gene AB

  12. Homologs … Homologs = Genes of common origin Orthologs = 1. Genes resulting from a speciation event, 2. Genes originating from an ancestral gene in the last common ancestor of the compared genomes Co-orthologs = Orthologs that have undergone lineage-specific gene duplications subsequent to a particular speciation event Paralogs = Genes resulting from gene duplication Inparalogs = Paralogs resulting from lineage-specific duplication(s) subsequent to a particular speciation event Outparalogs = Paralogs resulting from gene duplication(s) preceding a particular speciation event One-to-one (1:1) orthologs = Orthologs with no (known) lineage-specific gene duplications subsequent to a particular speciation event One-to-many (1:n) orthologs: Orthologs of which at least one - and at most all but one - has undergone lineage-specific gene duplication subsequent to a particular speciation event Many-to-many (n:n) orthologs = Orthologs which have undergone lineage-specific gene duplications subsequent to a particular speciation event Xenologs = Orthologs derived by horizontal gene transfer from another lineage

  13. Relationships between orthologs and paralogs Frog gene A Orthologs (Group 1) Human gene A Mouse gene A Co-orthologs of Drosophila gene AB Gene duplication Inparalogs of Group 2 Orthologs (Group 2) Mouse gene B Ancestral gene Human gene B Outparalogs of Group 1 Frog gene B Drosophila gene AB

  14. Practical approach I Actin-related protein 2 (first 60 columns of the alignment) ARP2_A MESAP---IVLDNGTGFVKVGYAKDNFPRFQFPSIVGRPILRAEEKTGNVQIKDVMVGDE ARP2_B MDSQGRKVIVVDNGTGFVKCGYAGTNFPAHIFPSMVGRPIVRSTQRVGNIEIKDLMVGEE ARP2_C MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ARP2_D MDSQGRKVVVCDNGTGFVKCGYAGSNFPEHIFPALVGRPIIRSTTKVGNIEIKDLMVGDE ARP2_E MDSKGRNVIVCDNGTGFVKCGYAGSNFPTHIFPSMVGRPMIRAVNKIGDIEVKDLMVGDE *:* :* ******** *** *** . **::****::*: . *::::**:***:* Species are: Caenorhabditis briggsae Drosophila melanogaster Homo sapiens Mus musculus Schizosaccharomyces pombe Can you build a dendrogram (tree) for the sequences of the alignment? Can you assign the species to the corresponding sequences of the alignment?

  15. Phylogenetic analysis • Select Data • Alignment • Select a data model • Select a substitution model • Tree-building • [Distance matrix] • Tree-building • Tree evaluation

  16. Select data • To be considered: • Input data must be homolog! • Number of character states • Content of phylogenetic information • Size of the dataset • Automated cluster data from large datasets • etc

  17. Alignment • MSA methods • ClustalW • muscle • MAFFT • Probcons • T-coffee • … • See previous course …

  18. Data model = Characters selected for the analysis • To be considered: • Each character should be homolog! • Missing data (in some OTU) • Number of characters • etc

  19. Evolutionary models Phylogenetic tree-building presumes particular evolutionary models The model used influences the outcome of the analysis and should be considered in the interpretation of the analysis results • Which aspects are to be considered? • Frequencies of aa exchange • Change of aa frequencies during evolution • Between-site rate variation or Among-site substitution rate heterogenity • Presence of invariable sites

  20. Evolutionary models Notation, e.g. JTT JTT + F JTT + F + gamma (4 ) JTT + F + gamma (8 ) + I (under discussion) JTT + F + I It is not always the most complex model that produces the best result. The more complex the model, the more complex the explanation of the results.

  21. Tree-building methods • Distance (matrix) methods • Calculate distances for all pairs of taxa based on the sequence alignment • Construct a phylogenetic tree based on a distance matrix • Character-based (Sequence) methods • Constructs a phylogenetic tree based on the sequence alignment

  22. Step 1: Compute distances • Estimate the number of amino acid substitutions between sequence pairs p distance: p=nd/n p = proportion (p distance) nd= number of aa differences n = number of aa used ^

  23. Step 1: Compute distances • Nonlinear relationship of p with t (time) • Estimation of aa substitutions • Poisson correction • PC distance • Gamma correction • Gamma distance

  24. Step 2: Tree-building Common distance methods • Neighbor Joining (NJ) • UPGMA / WPGMA • Least Square (LS) • Minimal Evolution (ME)

  25. Neighbor Joining (NJ) • Saitou, Nei (1987) • Principle • Clustering method • Simplified minimal evolution principle • Neighbors = taxa connected by a single node in an unrooted tree • Computational process: Star tree, followed by a successive joining of neighbors and the creation of new pairs of neighbors • Result: • A single final tree with branch length estimates • unrooted tree

  26. Neighbor Joining (NJ) • Sum of branch lengths in the star tree • Calculate the sum of all branch lengths for all possible neighbors …

  27. Neighbor Joining (NJ) • Calculate Length X-Y • Calculate again sum of all branch length

  28. Neighbor Joining (NJ)

  29. Neighbor Joining (NJ) • Advantage • Very efficient • Also for large datasets • Disadvantage • Does not examine all possible topologies

  30. Bootstrap • Used to test the robustness of a tree topology • by Bradley Efron (1979) • Felsenstein (1985) • Principle: new MSA datasets are created by choosing randomly N columns from the original MSA; where N is the length of the original MSA • 100-1000 replicates • Bootstrap support values: (75%), 95%, 98%

  31. TP5 - 1st part, Exercises 1-5 http://education.expasy.org/m07_phylo.html

  32. Ortholog databases & phylogenetic databases Some databases providing orthologous groups and trees • COG/KOG • HOGENOM • Ensembl • OMA browser • OrthoDB • OrthoMCL • Pfam • PANDIT • SYSTERS • TreeBase • Tree of Life

  33. Phylogenetic software Software packages • Freely available • Phylip • BioNJ • PhyML • Tree Puzzle • MrBayes • Commercial • PAUP • MEGA

  34. Phylogenetic servers • http://www.phylogeny.fr/ • http://bioweb.pasteur.fr/seqanal/phylogeny/intro-uk.html • http://atgc.lirmm.fr/phyml/ • http://phylobench.vital-it.ch/raxml-bb/ • http://www.fbsc.ncifcrf.gov/app/htdocs/appdb/drawpage.php?appname=PAUP • http://power.nhri.org.tw/power/home.htm

  35. Sequence methods Most common: • Maximum Parsimony (MP) • Maximum Likelihood (ML) • Baysian Inference

  36. Maximum Parsimony (MP) • Originally developed for morphological characters • Henning, 1966 • William of Ockham: the best hypothesis is the one that requires the smallest number of assumptions

  37. Maximum Parsimony (MP) • Principle: • Estimate the minimum number of substitutions for a given topology • Parsimony-informative sites (exclude invariable sites and singletons) • Searching MP trees • Exhaustive search • Branch-and-bound (Hendy-Penny, 1982) • Good but time-consuming, if m>20 • Heuristic search • Result tree might not be the most parsimonious tree • Result • Multiple result trees are possible (strict consensus tree, majority-rule consensus tree) • Most parsimonious tree vs true tree • Unrooted result trees

  38. Maximum Parsimony (MP) • Advantages • Free from assumptions (model-free) • Disadvantages • Does not take into account homoplasy • Long-branch attraction (LBA): creates wrong topologies, if the substitution rate varies extensively between lineages

  39. Maximum Likelihood (ML) • Cavalli-Sforza, Edwards (1967), gene frequency data • Felsenstein (1981), nucleotide sequences • Kishino (1990), proteins • Principle • Maximizes the likelihood of observing the sequence data for a specific model of character state changes • Likelihood of a site = Sum of probabilities of every possible reconstruction of ancestral states at the internal nodes • Likelyhood of the tree = Product of the likelihoods for all sites (=sum of log likelihoods) • Result = tree with the highest likelihood • Maximized to estimate branch lengths, not topologies • Search strategies: rarely exhaustive, mostly heuristic • NNI (Nearest neighbor interchanges) • TBR (Tree bisection-reconnection) • SPR (Subtree pruning and regrafting)

  40. Number of possible trees • Unrooted bifurcating trees: • Rooted bifurcating trees:

  41. Number of possible trees Rooted Unrooted Leaves

  42. Number of possible trees Leaves Unrooted Rooted 3 1 3 4 3 15 5 15 105 6 105 945 7 945 10395 8 10395 135135 9 135135 2027025 10 2027025 34459425

  43. Maximum Likelihood (ML) • Methods: • ProML (Phylip) • PhyML • RaxML • …

  44. Tree evaluation • Topology • Comparison with species tree • Robustness, e.g. bootstrap • Branch lengths

  45. TP5 – 2nd part, Exercise 6 http://education.expasy.org/m07_phylo.html

More Related