norman
Uploaded by
45 SLIDES
755 VUES
460LIKES

Protein Structure, classification, Prediction and Proteomics

DESCRIPTION

Protein Structure, classification, Prediction and Proteomics . Protein Structure. Obtaining 3-D structure. Obtaining 3-D structure (NMR). Obtaining 3-D structure (Bioinformatics). 3-D structure (dynamics / computation). Subdomain Rearrangement in HIV-1 Reverse Transcriptase .

1 / 45

Télécharger la présentation

Protein Structure, classification, Prediction and Proteomics

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Protein Structure, classification, Prediction and Proteomics

  2. Protein Structure

  3. Obtaining 3-D structure

  4. Obtaining 3-D structure (NMR)

  5. Obtaining 3-D structure (Bioinformatics)

  6. 3-D structure (dynamics / computation) Subdomain Rearrangement in HIV-1 Reverse Transcriptase

  7. Protein Databases UniProt is the universal protein database, a central repository of protein data created by combining Swiss-Prot, TrEMBL and PIR. This makes it the world's most comprehensive resource on protein information. The Protein Information Resource (PIR), located at Georgetown University Medical Center (GUMC), is an integrated public bioinformatics resource to support genomic and proteomic research, and scientific studies. Swiss-Prot is a curated biological database of protein sequences from different species created in 1986 by Amos Bairoch during his PhD and developed by the Swiss Institute of Bioinformatics and the European Bioinformatics Institute. Pfam is a large collection of multiple sequence alignments and hidden Markov models covering many common protein domains and families. PDB NCBI http://proteome.nih.gov/links.html

  8. PubMed – Protein Databases The Protein database contains sequence data from the translated coding regions from DNA sequences in GenBank, EMBL, and DDBJ as well as protein sequences submitted to Protein Information Resource (PIR), SWISS-PROT, Protein Research Foundation (PRF), and Protein Data Bank (PDB) (sequences from solved structures). The Structure database or Molecular Modeling Database (MMDB) contains experimental data from crystallographic and NMR structure determinations. The data for MMDB are obtained from the Protein Data Bank (PDB). The NCBI has cross-linked structural data to bibliographic information, to the sequence databases, and to the NCBI taxonomy. Use Cn3D, the NCBI 3D structure viewer, for easy interactive visualization of molecular structures from Entrez. Tutorial: http://www.pdb.org/pdbstatic/tutorials/tutorial.html

  9. Example – PDB • http://www.pdb.org • Only proteins with known structures are included.

  10. Protein Visualization Softwares • Cn3d • RasMol • TOPS • Chime • DSSP • Molscript • Ribbons • MSMS • Surfnet • …

  11. PubMed Structure Database

  12. PubMed Structure Database

  13. Protein Structure Classification - SCOP • Structure Classification Of Proteins database • http://scop.mrc-lmb.cam.ac.uk/scop/ • Hierarchical Clustering • Family – clear evolutionarily relationship • Superfamily – probable common evolutionary origin • Fold – major structural similarity • Boundaries between levels are more or less subjective • Conservative evolutionary classification leads to many new divisions at the family and superfamily levels, therefore it is recommended to first focus on higher levels in the classification tree.

  14. Protein Structure Classification - SCOP • a/a • b/b • a/b • a+b • Misc

  15. Protein Structure Classification - SCOP Scop Classification StatisticsSCOP: Structural Classification of Proteins. 1.69 release25973 PDB Entries (1 Oct 2004). 70859 Domains. 1 Literature Reference(excluding nucleic acids and theoretical models)

  16. Protein Structure Classification - SCOP

  17. Protein Structure Classification - SCOP

  18. Protein Structure Classification - SCOP

  19. Protein Structure Classification - SCOP

  20. Protein Structure Classification - SCOP

  21. Protein Structure Classification - CATH • CATH Protein Structure Classification • http://www.cathdb.info/latest/index.html • CATH is a hierarchical classification of protein domain structures, which clusters proteins at four major levels, Class(C), Architecture(A), Topology(T) and Homologous superfamily (H). • Class, derived from secondary structure content, is assigned for more than 90% of protein structures automatically. • Architecture, which describes the gross orientation of secondary structures, independent of connectivities, is currently assigned manually. • The topology level clusters structures into fold groups according to their topological connections and numbers of secondary structures. • The homologous superfamilies cluster proteins with highly similar structures and functions. The assignments of structures to fold groups and homologous superfamilies are made by sequence and structure comparisons.

  22. Protein Structure Classification - CATH

  23. CATH vs. SCOP

  24. Secondary Structure Prediction AGADIR - An algorithm to predict the helical content of peptides APSSP - Advanced Protein Secondary Structure Prediction Server GOR - Garnier et al, 1996 HNN - Hierarchical Neural Network method (Guermeur, 1997) Jpred - A consensus method for protein secondary structure prediction at University of Dundee JUFO - Protein secondary structure prediction from sequence (neural network) nnPredict - University of California at San Francisco (UCSF) Porter - University College Dublin PredictProtein - PHDsec, PHDacc, PHDhtm, PHDtopology, PHDthreader, MaxHom, EvalSec from Columbia University Prof - Cascaded Multiple Classifiers for Secondary Structure Prediction PSA - BioMolecular Engineering Research Center (BMERC) / Boston PSIpred - Various protein structure prediction methods at Brunel University SOPMA - Geourjon and Deléage, 1995 SSpro - Secondary structure prediction using bidirectional recurrent neural networks at University of California DLP - Domain linker prediction at RIKEN http://us.expasy.org/tools/#secondary

  25. Secondary Structure Prediction - HNN • http://npsa-pbil.ibcp.fr/cgi-bin/secpred_hnn.pl • >gi|78099986|sp|P0ABK2|CYDB_ECOLI Cytochrome d ubiquinol oxidase subunit 2 (Cytochrome d ubiquinol oxidase subunit II) (Cytochrome bd-I oxidase subunit II) MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTERRIMINSIAPHWDGNQVWLITAGGA LFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGFDYRSKIEETRWRNMWDWGIFIGSFVPPLVIGVAFGN LLQGVPFNVDEYLRLYYTGNFFQLLNPFGLLAGVVSVGMIITQGATYLQMRTVGELHLRTRATAQVAALV TLVCFALAGVWVMYGIDGYVVKSTMDHYAASNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTI LTARMDKAAWAFVFSSLTLACIILTAGIAMFPFVMPSSTMMNASLTMWDATSSQLTLNVMTWVAVVLVPIILLYTAWCYWKMFGRITKEDIERNTHSLY

  26. Secondary Structure Prediction - HNN Sequence length : 379 HNN : Alpha helix (Hh) : 209 is 55.15% 310 helix (Gg) : 0 is 0.00% Pi helix (Ii) : 0 is 0.00% Beta bridge (Bb) : 0 is 0.00% Extended strand (Ee) : 55 is 14.51% Beta turn (Tt) : 0 is 0.00% Bend region (Ss) : 0 is 0.00% Random coil (Cc) : 115 is 30.34% Ambigous states (?) : 0 is 0.00% Other states : 0 is 0.00% 10 20 30 40 50 60 70 | | | | | | | MIDYEVLRFIWWLLVGVLLIGFAVTDGFDMGVGMLTRFLGRNDTERRIMINSIAPHWDGNQVWLITAGGA ccchhhhhhhhhhhhhhheeeeehccchhcchhhhhheecccccceeeeeeccccccccceeeeeeccch LFAAWPMVYAAAFSGFYVAMILVLASLFFRPVGFDYRSKIEETRWRNMWDWGIFIGSFVPPLVIGVAFGN hhhhhhhhhhhhhhhhhhhhhhhhhhhhhcccccccccchhhhhhhhhhcceeehccchccheehhhhhc LLQGVPFNVDEYLRLYYTGNFFQLLNPFGLLAGVVSVGMIITQGATYLQMRTVGELHLRTRATAQVAALV hhcccccchhhhheeeeccchhhhhcchceccceeeeeeeeeccchhhhhhhchhhhhhchhhhhhhhhh TLVCFALAGVWVMYGIDGYVVKSTMDHYAASNPLNKEVVREAGAWLVNFNNTPILWAIPALGVVLPLLTI hhhhhhccceeeeeeccceeeeeccccccccccchhhhhhhhhhhheeccccceeeeccchhhhhhhhhh LTARMDKAAWAFVFSSLTLACIILTAGIAMFPFVMPSSTMMNASLTMWDATSSQLTLNVMTWVAVVLVPI hhhhhhhhhhhhhhhhhhhhhhhhhcchhhcccccccchhhccccchhcccchhhhhhhhhhhhhhhhhh ILLYTAWCYWKMFGRITKEDIERNTHSLY hhhhhhhhhhhhhhhcchhhhhhhccccc

  27. Secondary Structure Prediction - HNN

  28. Motifs Readily Identified from Sequence • Zinc Finger - order and spacing of a pattern for cysteine and histidine. • Leucine zippers – two antiparallel alpha helices held together by interactions between hybrophobic leucine residues at every seventh position in each helix. • Coiled coils – 2-3 helices coiled around each other in a left-handed supercoil (3.5 residue/turn instead of 3.6 – 7/two turns); first and fourth are always hydrophobic, others hydrophilic; 5-10 heptads. • Transmembrane-spanning proteins – alpha helices comprising amino acids with hydrophobic side chains, typically 20-30 residues.

  29. Topology Prediction PSORT - Prediction of protein subcellular localization TargetP - Prediction of subcellular location DAS - Prediction of transmembrane regions in prokaryotes using the Dense Alignment Surface method (Stockholm University) HMMTOP - Prediction of transmembrane helices and topology of proteins (Hungarian Academy of Sciences) PredictProtein - Prediction of transmembrane helix location and topology (Columbia University) SOSUI - Prediction of transmembrane regions (Nagoya University, Japan) TMAP - Transmembrane detection based on multiple sequence alignment (Karolinska Institut; Sweden) TMHMM - Prediction of transmembrane helices in proteins (CBS; Denmark) TMpred - Prediction of transmembrane regions and protein orientation (EMBnet-CH) TopPred - Topology prediction of membrane proteins (France) http://us.expasy.org/tools

  30. Tertiary Structure Prediction • Comparative modeling • SWISS-MODEL - An automated knowledge-based protein modelling server • 3Djigsaw - Three-dimensional models for proteins based on homologues of known structure • CPHmodels - Automated neural-network based protein modelling server • ESyPred3D - Automated homology modeling program using neural networks • Geno3d - Automatic modeling of protein three-dimensional structure • SDSC1 - Protein Structure Homology Modeling Server • Threading • 3D-PSSM - Protein fold recognition using 1D and 3D sequence profiles coupled with secondary structure information (Foldfit) • Fugue - Sequence-structure homology recognition • HHpred - Protein homology detection and structure prediction by HMM-HMM comparison • Libellula - Neural network approach to evaluate fold recognition results • LOOPP - Sequence to sequence, sequence to structure, and structure to structure alignment • SAM-T02 - HMM-based Protein Structure Prediction • Threader - Protein fold recognition • ProSup - Protein structure superimposition • SWEET - Constructing 3D models of saccharides from their sequences • Ab initio • HMMSTR/Rosetta - Prediction of protein structure from sequence • http://us.expasy.org/tools

  31. Tertiary Structure Prediction • Comparative modeling • 3Djigsaw - Three-dimensional models for proteins based on homologues of known structure Contreras-Moreira,B., Bates,P.A. (2002) Domain Fishing: a first step in protein comparative modelling. Bioinformatics18: 1141-1142.

  32. Tertiary Structure Prediction • Threading • 3D-PSSM - Protein fold recognition using 1D and 3D sequence profiles coupled with secondary structure information (Foldfit) • Fugue - Sequence-structure homology recognition • HHpred - Protein homology detection and structure prediction by HMM-HMM comparison • Libellula - Neural network approach to evaluate fold recognition results • LOOPP - Sequence to sequence, sequence to structure, and structure to structure alignment • SAM-T02 - HMM-based Protein Structure Prediction • Threader - Protein fold recognition • ProSup - Protein structure superimposition • SWEET - Constructing 3D models of saccharides from their sequences

  33. Tertiary Structure Prediction • Threading • The term threading was first coined by Jones, Taylor and Thornton in 1992, and originally referred specifically to the use of a full 3-D structure atomic representation of the protein template in fold recognition. Today, the terms threading and fold recognition are frequently (though somewhat incorrectly) used interchangeably. • The basic idea is that the target sequence (the protein sequence for which the structure is being predicted) is threaded through the backbone structures of a collection of template proteins (known as the fold library) and a “goodness of fit” score calculated for each sequence-structure alignment. This goodness of fit is often derived in terms of an empirical energy function, based on statistics derived from known protein structures, but many other scoring functions have been proposed and tried over the years. • Threading methods share some of the characteristics of both comparative modelling methods (the sequence alignment aspect) and ab initio prediction methods (predicting structure based on identifying low-energy conformations of the target protein). • http://en.wikipedia.org/wiki/Threading_%28protein_sequence%29

  34. Tertiary Structure Prediction • Ab initio (de novo) • From scratch – using physical property instead of known structures • Mimic folding process – minimize certain energy function, stochastic modeling (e.g., simulated annealing) • Computationally expensive – requires large clusters, large machines (e.g., IBM BlueGene) or distributed computing, currently only work for small peptides • Big potential in the future – understand the dynamics, accuracy, and applications in drug development

  35. Tertiary Structure Prediction • Ab initio (de novo) • Prediction Scoring with RosettaRosetta uses a scoring function to judge different conformations. The process consists of making 'moves' (changing the bond angles of a particular group of amino acids) and then scoring the new conformation. • The Rosetta score is a weighted sum of component scores, where each component score is judging a different aspect of protein structure. • Environment score: Here, hydrophobic residues as represented as orange stars, so the left conformation is good (all the hydrophobics together) while the rightmost conformation is bad (with the hydrophobic amino acids not touching). • Pair-score: Two conformations of a polypeptide are shown, one (top) where the chain is folded back on itself bringing two cysteins together (yellow+yellow = possible disulphide bond) and forming a salt-bridge (blue+red = opposites attract). The conformation at bottom does not make these pairings and the pair-score would, thus, favor the top conformation. • http://www.grid.org/projects/hpf/howitworks_scoring.htm

  36. Evaluation - CASP • CASP - Critical Assessment of Techniques for Protein Structure Prediction, is a community-wide experiment (though it is commonly referred to as a competition) for protein structure prediction taking place every two years since 1994. (http://predictioncenter.org/) • The main goal of CASP is to obtain an in-depth and objective assessment of our current abilities and inabilities in the area of protein structure prediction. To this end, participants will predict as much as possible about a set of soon to be known structures. These will be true predictions, not ‘post-dictions’ made on already known structures. CASP7 will particularly address the following questions: • Are the models produced similar to the corresponding experimental structure? • Is the mapping of the target sequence onto the proposed structure (i.e. the alignment) correct? • Have similar structures that a model can be based on been identified? • Are comparative models more accurate than can be obtained by simply copying the best template? • Has there been progress from the earlier CASPs? • What methods are most effective? • Where can future effort be most productively focused?

  37. Evaluation - CASP • Evaluation of the results is carried out in the following prediction categories: • tertiary structure prediction (all CASPs) • secondary structure prediction (dropped after CASP5) • prediction of structure complexes (CASP2 only; a separate experiment - CAPRI - carries on this subject) • residue-residue contact prediction (starting CASP4) • disordered regions prediction (starting CASP5) • domain boundary prediction (starting CASP6) • function prediction (starting CASP6) • model quality assessment (starting CASP7) • model refinement (starting CASP7) • Tertiary structure prediction category was further subdivided into • homology modelling • fold recognition (also called protein threading; Note, this is incorrect as threading is a method) • de novo structure prediction Now referred to as 'New Fold' as many methods apply evaluation, or scoring, functions that are biased by knowledge of native protein structures, such an example would be an artificial neural network.

  38. Evaluation - CASP

  39. Proteomics The term proteome was coined by Mark Wilkins in 1995 and is used to describe the entire complement of proteins in a given biological organism or system at a given time, i.e. the protein products of the genome. The term has been applied to several different types of biological systems. A cellular proteome is the collection of proteins found in a particular cell type under a particular set of environmental conditions such as exposure to hormone stimulation.

  40. Proteomics vs. Genomics The proteome is larger than the genome, especially in eukaryotes, in the sense that there are more proteins than genes. This is due to alternative Splicing_(genetics) splicing of genes and post-translational modifications like glycosylation or phosphorylation. The proteome has at least two levels of complexity lacking in the genome. When the genome is defined by the sequence of nucleotides, the proteome cannot be limited to the sum of the sequences of the proteins present. Knowledge of the proteome requires knowledge of (1) the structure of the proteins in the proteome and (2) the functional interaction between the proteins.

  41. Proteomics Techniques – 2D Gel Proteomics, the study of the proteome, has largely been practiced through the separation of proteins by two dimensional gel electrophoresis. In the first dimension, the proteins are separated by isoelectric focusing, which resolves proteins on the basis of charge. In the second dimension, proteins are separated by molecular weight using SDS-PAGE. The gel is dyed with Coomassie Blue or silver to visualize the proteins. Spots on the gel are proteins that have migrated to specific locations. Matching is a big issue

  42. Proteomics Techniques – Mass Spec Peptide mass fingerprinting identifies a protein by cleaving it into short peptides and then deduces the protein's identity by matching the observed peptide masses against a sequence database. Tandem mass spectrometry, on the other hand, can get sequence information from individual peptides by isolating them, colliding them with a nonreactive gas, and then cataloging the fragment ions produced.

  43. Proteomics Techniques – Mass Spec

  44. Proteomics Techniques – Mass Spec

  45. Proteomics Techniques – Microarray Measures mRNA level, no change in mRNA does not necessarily mean no change in protein expression and function due to effects of posttranslational modulation.

More Related
SlideServe
Audio
Live Player
Audio Wave
Play slide audio to activate visualizer