1 / 14

Investigations of HIV-1 Env Evolution

Investigations of HIV-1 Env Evolution. University of Tennessee - Knoxville June 22-26, 2009. HIV Life Cycle. HIV Virus. The HIV Genome. HIV env Gene. gp120 V3 region sequence. Nucleic Acid Sequence CTAGCAGAAGAAGAGGTAGTAATTAGATCTGCCAATTTCACAGACAATGCTAAAATCATAATAGTACAGC

temima
Télécharger la présentation

Investigations of HIV-1 Env Evolution

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. Investigations of HIV-1 Env Evolution University of Tennessee - Knoxville June 22-26, 2009

  2. HIV Life Cycle

  3. HIV Virus

  4. The HIV Genome

  5. HIV env Gene

  6. gp120 V3 region sequence Nucleic Acid Sequence CTAGCAGAAGAAGAGGTAGTAATTAGATCTGCCAATTTCACAGACAATGCTAAAATCATAATAGTACAGC TGAATGCATCTGTAGAAATTAATTGTACAAGGCCCAACAACAATACAAGAAAAGGTATACATATAGGACC AGGGAGAGCATTTTATGCAACAGGAGAAATAATAGGAGATATAAGACAAGCACATTGTAACATTAGTAGA GAAAAATGGAATAATACTTTAAACCAGGTAGTTACAGAATTAAGGGAACAATTTGGGAATAAAACAATAA CCTTTAATCACTCCTCAGGAGGGGACCCAGAAATTGTAATGCACAGTTTTAATTGTGGAGGGGAATTTTT CTATTGTAAT ------------------------------------------------------------------------ Amino Acid Sequence LAEEEVVIRSANFTDNAKIIIVQLNASVEINCTRPNNNTRKGIHIGPGRAFYATGEIIGDIRQAHCNISR EKWNNTLNQVVTELREQFGNKTITFNHSSGGDPEIVMHSFNCGGEFFYCN

  7. gp 120 Structure

  8. The Markham et al.HIV-1 env Sequence Dataset Richard Markham and his colleagues (1998), published some research on the pattern of HIV evolution and the rate of CD4 T-cell decline in the Proceedings of the National Academy of Sciences. In addition to the journal article they submitted 666 nucleotide sequences to the GenBank database. They studied a 285 base pair region of the env gene. The gene product, membrane protein gp120, binds to the CD4 receptor site on T-lymphocytes and is involved with the entry of the virus into those cells. Markham et al. followed the evolution of this viral gene sequence in 15 subjects by collecting blood samples at six month intervals for up to four years. For each visit all the forms of the gene (clones) were sequenced and CD4 T-cell counts were made. This data set provides a rich resource for looking closely at the patterns of change in HIV over time.

  9. Summary of the data set • Subjects: 15 • Number of visits: 3-9 • Number of clones per visit: 2-18 • Total number of sequences available: 666 • CD4 cell counts for each visit

  10. Possible Investigations • What is the pattern of HIV evolution within an individual? • Do the number of clones over time change in any regular way? • Do certain clones appear to survive (leave descendents) over time while other disappear (go extinct)?

  11. Possible Investigations • What is the pattern of HIV evolution within the env sequence? • Are there particular positions in the sequence that are more or less likely to mutate? • Are there different rates of synonymous (silent) and non-synonymous mutations?

  12. User Web Browser User Input Output to User Results to User User Instructions and queries Application Programs (May have varying interfaces and be written in different languages) Information Sources (May be of varying formats) Workbench Server Instructions Queries Format Translator, Query Engine and Program Driver Results Information The NCSA Information Workbench - An Architecture for Web-Based Computing NCSA Computational Biology Group

More Related