1 / 2

adamts2 gene

Anti-ADAMTS2 monoclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/Anti-ADAMTS2-MAb-169261-144.htmt

bocsci2018
Télécharger la présentation

adamts2 gene

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. Anti-ADAMTS2 monoclonal antibody, clone 8H4 Anti-ADAMTS2 monoclonal antibody, clone 8H4 (DCABH-10414) (DCABH-10414) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Antigen Description Antigen Description This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene excises the N-propeptide of type I, type II and type V procollagens. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in two transcript variants. The short transcript encodes a protein which has no significant procollagen N-peptidase activity. Immunogen Immunogen ADAMTS2 (NP_055059, 1112 a.a. ~ 1210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype Isotype IgG2a Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human, Rat Clone Clone 8H4 Conjugate Conjugate Unconjugated Applications Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); Sandwich ELISA (Recombinant protein); ELISA Sequence Similarities Sequence Similarities KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQ PPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGK Size Size 1 ea Buffer Buffer In 1x PBS, pH 7.4 Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved

  2. GENE INFORMATION GENE INFORMATION Gene Name Gene Name ADAMTS2 ADAM metallopeptidase with thrombospondin type 1 motif, 2 [ Homo sapiens ] Official Symbol Official Symbol ADAMTS2 Synonyms Synonyms ADAMTS2; ADAM metallopeptidase with thrombospondin type 1 motif, 2; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; A disintegrin and metalloproteinase with thrombospondin motifs 2; ADAM TS2; ADAMTS 3; hPCPNI; NPI; PCINP; procollagen I N proteinase; procollagen N endopeptidase; procollagen I N-proteinase; procollagen N-endopeptidase; procollagen I/II amino propeptide-processing enzyme; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; PNPI; PCPNI; PCI-NP; PC I-NP; ADAM-TS2; ADAMTS-2; ADAMTS-3; DKFZp686F12218; Entrez Gene ID Entrez Gene ID 9509 mRNA Refseq mRNA Refseq NM_014244 Protein Refseq Protein Refseq NP_055059 MIM MIM 604539 UniProt ID UniProt ID O95450 Chromosome Location Chromosome Location 5q23-q24 Function Function metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved

More Related