20 likes | 23 Vues
Anti-ADAMTS2 monoclonal antibody can be provided from Creative Diagnostics.<br>https://www.creative-diagnostics.com/Anti-ADAMTS2-MAb-169261-144.htmt
E N D
Anti-ADAMTS2 monoclonal antibody, clone 8H4 Anti-ADAMTS2 monoclonal antibody, clone 8H4 (DCABH-10414) (DCABH-10414) This product is for research use only and is not intended for diagnostic use. PRODUCT INFORMATION PRODUCT INFORMATION Antigen Description Antigen Description This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The enzyme encoded by this gene excises the N-propeptide of type I, type II and type V procollagens. Mutations in this gene cause Ehlers-Danlos syndrome type VIIC, a recessively inherited connective-tissue disorder. Alternative splicing results in two transcript variants. The short transcript encodes a protein which has no significant procollagen N-peptidase activity. Immunogen Immunogen ADAMTS2 (NP_055059, 1112 a.a. ~ 1210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Isotype Isotype IgG2a Source/Host Source/Host Mouse Species Reactivity Species Reactivity Human, Rat Clone Clone 8H4 Conjugate Conjugate Unconjugated Applications Applications Western Blot (Cell lysate); Western Blot (Recombinant protein); Sandwich ELISA (Recombinant protein); ELISA Sequence Similarities Sequence Similarities KHNDIDVFMPTLPVPTVAMEVRPSPSTPLEVPLNASSTNATEDHPETNAVDEPYKIHGLEDEVQ PPNLIPRRPSPYEKTRNQRIQELIDEMRKKEMLGK Size Size 1 ea Buffer Buffer In 1x PBS, pH 7.4 Storage Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 1 © Creative Diagnostics All Rights Reserved
GENE INFORMATION GENE INFORMATION Gene Name Gene Name ADAMTS2 ADAM metallopeptidase with thrombospondin type 1 motif, 2 [ Homo sapiens ] Official Symbol Official Symbol ADAMTS2 Synonyms Synonyms ADAMTS2; ADAM metallopeptidase with thrombospondin type 1 motif, 2; a disintegrin like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; A disintegrin and metalloproteinase with thrombospondin motifs 2; ADAM TS2; ADAMTS 3; hPCPNI; NPI; PCINP; procollagen I N proteinase; procollagen N endopeptidase; procollagen I N-proteinase; procollagen N-endopeptidase; procollagen I/II amino propeptide-processing enzyme; a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 2; PNPI; PCPNI; PCI-NP; PC I-NP; ADAM-TS2; ADAMTS-2; ADAMTS-3; DKFZp686F12218; Entrez Gene ID Entrez Gene ID 9509 mRNA Refseq mRNA Refseq NM_014244 Protein Refseq Protein Refseq NP_055059 MIM MIM 604539 UniProt ID UniProt ID O95450 Chromosome Location Chromosome Location 5q23-q24 Function Function metal ion binding; metalloendopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding; 45-1 Ramsey Road, Shirley, NY 11967, USA Email: info@creative-diagnostics.com Tel: 1-631-624-4882 Fax: 1-631-938-8221 2 © Creative Diagnostics All Rights Reserved