chaney
Uploaded by
50 SLIDES
674 VUES
500LIKES

CATS Bell Ringers

DESCRIPTION

CATS Bell Ringers. 1 st Marking Period. Thursday, August 26th. Bell Ringer: Please fill out the Technology Survey on your desk. . Agenda: 1. Technology Survey 2. Syllabus 3. Must Reads 4. Name Game 5. 2 Truths and a Lie. Essential Question: How well do you know each other?.

1 / 50

Télécharger la présentation

CATS Bell Ringers

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

Playing audio...

  1. CATS Bell Ringers 1st Marking Period

  2. Thursday, August 26th • Bell Ringer: • Please fill out the Technology Survey on your desk. • Agenda: • 1. Technology Survey • 2. Syllabus • 3. Must Reads • 4. Name Game • 5. 2 Truths and a Lie Essential Question: How well do you know each other?

  3. Friday, August 27th • Bell Ringer: • On the yellow tablet paper, write down: • TWO true things about yourself • ONE false, but plausible, thing about yourself • Agenda: • 1. Bell Ringer • 2. Must Reads • 3. Name Game Essential Question: How well do you know each other?

  4. Must Reads Activity • 1. Write a brief (3-5 sentences) summary of your book without giving away the ending. • 2. Look through the book and find a part of it that you really like and write down a quote (3-5 sentences). Be sure to include the page #. • 3. In 2-4 sentences, write down why you like this book.

  5. Monday, August 30th • Bell Ringer: Logic Puzzle! • A man lives on the 10th floor of a building. Every day, he takes the elevator to the first floor to go to work or to go shopping. When he returns, he always takes the elevator to the 7th floor and then walks the remaining flights of stairs to his apartment on the 10th floor. Why does he do this? • Agenda: • 1. Bell Ringer • 2. Must Reads Essential Question: What is your favorite book and why?

  6. Tuesday, August 31st • Bell Ringer: • On a busy Friday afternoon, a man walked several miles across London from Westminster to Knightsbridge without seeing anybody or being seen by anybody. The day was clear and bright. He had perfect eyesight and he looked where he was going. He did not travel by any method of transportation other than by foot. London was thronged with people yet not one of them saw him. How? • Agenda: • 1. Bell Ringer • 2. Must Reads • 3. Notes Essential Question: What is your favorite book and why?

  7. Wednesday, September 1st • Bell Ringer: Anthony and Cleopatra are lying dead on the floor in an Egyptian villa. Nearby is a broken bowl. There are no marks on their bodies and they were not poisoned. Not a person was in the villa when they died. How did they die? • Agenda: • 1. Bell Ringer • 2. Notes • 3. Analyze speeches Essential Question: What makes a good speech?

  8. Thursday, September 2nd • Bell Ringer: On a dark and rainy night a hitchhiker was having no luck finding a ride. Finally a car stopped and he got in. But something was very odd – there was no driver! Suddenly the car started moving. The hitchhiker saw a curve coming up and reached for the steering wheel but a hand came through the window and turned the car. The ride continued, and each time a cure came, the hand reached in and turned the car just in time. Finally the car stopped and the hitchhiker ran into a bar, ordered a drink, and told everyone what had just happened. Then two men came up to him. What did they say? • Agenda: • 1. Bell Ringer • 2. Notes • 3. Speech analysis Essential Question: What makes a good speech?

  9. Friday, September 3rd • Bell Ringer: • Five men were proceeding together down a country path. It began to rain. Four of the men quickened their step and began to walk faster. The fifth man made no effort to move any faster. However, he remained dry and the other four got wet. They all arrived at their destination together. How could this be so? • Agenda: • 1. Bell Ringer • 2. Notes • 3. Read and discuss speeches Essential Question: What makes a good speech?

  10. Tuesday, September 7th • The following words have had their vowels removed, can you find the missing animals? • RDVRKRNDRPRCPNRHNCRSSQRRLCLTFRRTSKNKDNKYNTLP • Agenda: • 1. Bell Ringer • 2. Notes • 3. Read and discuss speeches Essential Question: What makes a good speech?

  11. Answer • Aardvark • Reindeer • Porcupine • Rhinoceros • Squirrel • ocelot (or colt) • Ferret • Skunk • Donkey • Antelope

  12. Wednesday, September 8th • Bell Ringer: • Can you name four days which start with the letter "T"? • Tuesday, Thursday, today, and tomorrow! • Agenda: • 1. Bell ringer • 2. Chief Seattle speech • 3. FDR speech Essential Question: What makes a good speech?

  13. Thursday, September 9th • Bell Ringer: • Name an ancient invention, which is still used in some parts of the world today, that allows people to see through walls. • A window! • Agenda: • 1. bell ringer • 2. FDR speech • 3. Review Questions • 4. Introduce Birthday Speech Essential Question: What makes a good speech?

  14. Friday, September 10th • Bell Ringer: • A man had some wood. On Monday, it was in the shape of a cube. On Tuesday, he changed it into the shape of a cylinder, and on Wednesday, he changed it into the shape of a pyramid. He did not cut or carve the wood into these shapes. How did he do it? • Agenda: • 1. Bell Ringer • 2. Finish reviewing questions • 3. Brainstorm answer to Essential Question • 4. Introduce Birthday Speech Essential Question: What makes a good speech?

  15. Monday, September 13th • Bell Ringer: • Can you write out the roman numerals up to 20?? • Agenda: • 1. Bell Ringer • 2. How to write an outline • 3. Computer lab Essential Question: How do we make an outline?

  16. Tuesday, September 14th • Bell Ringer: The day before yesterday Freda was 17. Next year she will be 20. How can this be so? • Agenda: • 1. Bell Ringer • 2. Continue researching (see wikispace for new websites) • 3. Start working on your outline Essential Question: How do we make an outline?

  17. Answer • The statement was made on January the 1st. • Freda’s birthday is on December 31st • She was 17 the day before yesterday. She was 18 yesterday. She will be 19 this year and 20 next year.

  18. Thursday, September 16th • Bell Ringer: • A truck became wedged under a low bridge. It could not move forward or back without severely damaging its roof. The truck driver was perplexed until a little girl standing nearby suggested an easy solution. What was it? • Agenda: • 1. Work on outline • 2. Start making notecards Essential Question: How do we make notecards out of an outline?

  19. The little girl suggested that the driver let some air out of the truck’s tires. He let out enough air to lower the truck by the small amount required to let it pass under the bridge.

  20. Thursday, September 2nd • Bell Ringer: • What is it that a baby has more of than an adult? • Agenda: • 1. Bell Ringer • 2. Finish outlines • 3. Start on notecards • Homework: Outline and cards due Monday! Essential Question: How do we make notecards out of an outline?

  21. A baby is born with 350 separate bones. As the baby grows, some of these bones join together so that in maturity the same person only have 206 bones.

  22. Tuesday, September 21st • Bell Ringer: • Share 2 stories with me from yesterday! • Agenda: • 1. Stories • 2. Sign up for Speeches • 3. Practice speeches Essential Question: Why should we practice a speech before we have to give it?

  23. How to Practice • Pick a partner (someone you are comfortable with) • Find a spot in the room • Have your notecards out • Run through your speech – be serious! • After the speech, the partner is to write on a notecard and give to the speaker: • 1. 1 good thing about their speech. • 2. 1 thing that could be improved • 3. The most memorable part of the speech

  24. Thursday, September 2nd • Bell Ringer: • 1. Get out notes – review section on: What Non-Verbal Elements Make an Effective Speech? • Agenda: • 1.Review • 2. Speeches Essential Question: How can we be a helpful and attentive audience?

  25. Monday, September 27th • Bell Ringer: • Get ready for a few more speeches! • Agenda: • 1. Remaining speeches • 2. Self-Reflection • 3. Puzzles Essential Question: How can we be a helpful and attentive audience?

  26. Tuesday, September 28th • Bell Ringer: A passenger in a taxi tapped the driver on the shoulder to ask him something. The driver screamed, lost control of the cab, nearly hit a bus, drove over the curb, and stopped just inches from a large plate glass window. What was the driver’s explanation? • Agenda: • 1. Puzzle • 2. Non-verbal communication game Essential Question: How important is non-verbal communication?

  27. Answer to Puzzle • The driver explained to his worried passenger, “I’m sorry, it’s really not your fault. Today is my first day driving a cab. I have been driving a hearse for the last 25 years!”

  28. Pantomime game • A pantomime is a performance of a simple, everyday activity. It is a physical activity that is performed with much attention to detail. No props are used. The performer cannot speak or make any noises. It is totally silent. • Everyone will get a chance to participate. Each team will get 20 seconds to guess their teammates’ pantomime. If they cannot guess (without shouting!), then the other team gets the point!

  29. Thursday, September 2nd • Bell Ringer: • How did Archimedes, one of the first and greatest lateral thinkers, manage to sink a Roman fleet of ships in the Mediterranean sea? • Agenda: • 1. Pantomime reflection • 2. Persuasive Speech Essential Question: How are persuasive speeches different from an informational speech?

  30. He used a system of mirrors and lenses on a high cliff to focus the rays of the sun on the wooden and canvas Roman ships, destroying the entire fleet.

  31. Pantomime Self-Reflection • When playing the pantomime game, how did you figure out what they were acting out? • How important can facial expressions and hand gestures be to communication?

  32. Thursday, September 30th • Bell Ringer: • What occurs twice in a lifetime, once in a year, twice in a week, but never in a day? • Agenda: • 1. Bell Ringer • 2. Notes • 3. Video • 4. Sample speeches Essential Question: What are the steps of the Monroe Motivation Sequence?

  33. Friday, October 1st • Bell Ringer: Who is the best-known unknown person? • Agenda: • 1. Sample Speech • 2. Practice together • 3. Brainstorm Essential Question: What are the steps of the Monroe Motivation Sequence?

  34. Friday, October 1st • Bell Ringer: A man who wanted a drink walked into a bar. Before he could say a word, he was knocked unconscious. Why? • Agenda: • 1. Finish example • 2. Worksheet – brainstorm • 3. Computer lab 252 (if time) Essential Question: What are the steps of the Monroe Motivation Sequence?

  35. Tuesday, October 5th • Bell Ringer: (next slide) • Agenda: • 1. Bell Ringer • 2. Google Wonder Wheel • 3. Research Essential Question: How can we use research to support our persuasive speeches?

  36. What is represented by this BrainBat? • D A EC N • Answer: Square Dance • getgetgetgetmenot • Answer: Forget-me-not (a flower).

  37. Tuesday, October 12th • Bell Ringer: • Brainbats, next slide • Agenda: • 1. Sample speech/outline • 2. sign up for slots • 3. work time Essential Question: How can I make this outline work for me?

  38. 100mph sausages90mph bananas110mph peanuts • Fast food • O R S E M A N • A headless horseman: the word HORSEMAN is missing the initial H.

  39. Wednesday, October 13th • Bell Ringer: • Next slide • Agenda: • 1. Bell Ringer • 2. My speech • 3. Practice with a partner Essential Question:

  40. You are in a room with 2 doors leading out. Behind 1 door is a coffer overflowing with jewels and gold, along with an exit. Behind the other door is an enormous, hungry lion that will pounce on anyone opening the door. You do not know which door leads to the treasure and exit, and which door leads to the lion. In the room you are in are 2 individuals. The first is a knight, who always tells the truth, and a knave, who always lies. Both of these individuals know what is behind each door. You do not know which individual is the knight, or which one is the knave. You may ask one of the individuals exactly 1 question. What should you ask in order to be certain that you will open the door with the coffer behind it, instead of the hungry lion? • Answer: You ask one of the individuals what the other one would say if you asked him which door is holding back the hungry lion and then open this door.

  41. Friday, October 15th • Bell Ringer: • Agenda: • 1. Speeches by • Nate • Kayla • Mia • Gabe • Anna • Mike • Adam 2. Puzzles Essential Question:

  42. Monday, October 18th • Bell Ringer: • Agenda: • Kayla • Lexie • Hanna • Amanda M • Courtney • Amanda S • Matt • Caitlyn • Dan Essential Question:

  43. Tuesday, October 19th • Bell Ringer: h a n d m e • Agenda: • 1. Matt • 2. Amanda M • 3. Caitlyn? • 4. Megan • 5. Mackenzie • 5. Anastasia • 6. Nick • 7. John • 8. Brad • 9. Darin Essential Question:

  44. Friday, October 1st • Bell Ringer: • Agenda: • 1. Matt • 2. Amanda M • 3. Mackenzie • 4. Nick • 5. John • 6. Anastasia • Advertisements Essential Question:

  45. Thursday, October 21st • Bell Ringer: • Get your ads and notebook paper out from yesterday • Agenda: • Speeches? • Self-Reflection • Advertisements Analysis Essential Question: Do we see any similarities in our advertisements?

  46. Self-Reflection • Answer the following questions: • On a scale of 1-10 (10 being the best), how would you rate your speech? Why? • What was the best part of your speech? • What surprised you about your speech? • What one thing about giving speeches will you remember after this class?

  47. Questions for your Ad • What product is your ad selling? How well does the picture match the product? • What audience do you think this ad is for? • What emotions is the viewer supposed to feel? • How do the colors, font, placement of pictures, etc. affect your understanding of the ad?

  48. Friday, October 22nd • Bell Ringer: • Get out a piece of paper and answer the following question: • How much do you think advertising has an impact on your life? • Agenda: • 1. Question • 2. speeches? • 3. Video • 4. Discussion Essential Question: What’s the message of the documentary, The Merchants of Cool?

  49. Friday, October 1st • Bell Ringer: • Agenda: Essential Question:

  50. Friday, October 1st • Bell Ringer: • Agenda: Essential Question:

More Related