10 likes | 120 Vues
Dive into the intricate details of nucleic acid binding domains in proteins, exploring motifs, active sites, and interaction regions. Unravel the significance of Cys motifs and the essential role they play in DNA and RNA binding. Discover the lysine-rich cores and their impact on protein function. Gain insights into the structural dynamics and functions of these crucial components.
E N D
a. ORF II 88 110 SEA AGSNTQGQYKAPPKKGIKRKYPA SA ......................G Nucleic acid binding domain b. ORF III (i) Cys motif 1 (CP) CXCX2CX4HX4C Lysine-rich core SAKKRKILKRVTNYNKNRRKNYVRRPSIKKKCRCYICQDENHLANRC Wb/Ap/Pb ....T........R.K......K.N..R................. Kk ....TP.......R.K....A.K.N..R................. (ii) Cys motif 2 (region between CP and PR) CX2CX11CX2CX4CX2C PhCEICSYFTDYNKTVSCKTCETQYCKTC Ch/Se .................I......... SA .D..D.Y..F.KT.V.....I...T.. (iii) CP regon interacting with ORF II 739 732 SEAFCRSIYTIA SA ......... (iv) RT active site Ph/Ch SA/Se SFGDLKFALLYIDDILIASNNEK ...................S..Q c. ORF IV Ph Ch Se Wb/Kk Ap Pb LKDQVSLLQKQNSELRARIATNKEIIEGL ......T...................... .RE...H.KNTVETQKQQLREMRDKL... .RE...H.KNTVETQKQQLREMRDKL... .RE...H.KNTIETQKQQ.REMRDK.... Ph/Ch Se Wb/Kk Ap Pb Imperfect Leucine zipper Supplementary Fig. 3