1 / 1

Supplementary Fig. 3

a. ORF II. 88. 110. SEA AGSNTQGQYKAPP KK GI KRK YPA SA ............... . ......G. Nucleic acid binding domain. b. ORF III. (i) Cys motif 1 (CP). CXCX 2 CX 4 HX 4 C. Lysine-rich core. SA KK R K IL K RVTNYN K NRR K NYVRRPSI KKKC R C YI C QDENHLANR C

tallys
Télécharger la présentation

Supplementary Fig. 3

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript

  1. a. ORF II 88 110 SEA AGSNTQGQYKAPPKKGIKRKYPA SA ......................G Nucleic acid binding domain b. ORF III (i) Cys motif 1 (CP) CXCX2CX4HX4C Lysine-rich core SAKKRKILKRVTNYNKNRRKNYVRRPSIKKKCRCYICQDENHLANRC Wb/Ap/Pb ....T........R.K......K.N..R................. Kk ....TP.......R.K....A.K.N..R................. (ii) Cys motif 2 (region between CP and PR) CX2CX11CX2CX4CX2C PhCEICSYFTDYNKTVSCKTCETQYCKTC Ch/Se .................I......... SA .D..D.Y..F.KT.V.....I...T.. (iii) CP regon interacting with ORF II 739 732 SEAFCRSIYTIA SA ......... (iv) RT active site Ph/Ch SA/Se SFGDLKFALLYIDDILIASNNEK ...................S..Q c. ORF IV Ph Ch Se Wb/Kk Ap Pb LKDQVSLLQKQNSELRARIATNKEIIEGL ......T...................... .RE...H.KNTVETQKQQLREMRDKL... .RE...H.KNTVETQKQQLREMRDKL... .RE...H.KNTIETQKQQ.REMRDK.... Ph/Ch Se Wb/Kk Ap Pb Imperfect Leucine zipper Supplementary Fig. 3

More Related