tallys
Uploaded by
1 SLIDES
121 VUES
10LIKES

Understanding Nucleic Acid Binding Domains in Proteins: Structure and Function

DESCRIPTION

Dive into the intricate details of nucleic acid binding domains in proteins, exploring motifs, active sites, and interaction regions. Unravel the significance of Cys motifs and the essential role they play in DNA and RNA binding. Discover the lysine-rich cores and their impact on protein function. Gain insights into the structural dynamics and functions of these crucial components.

1 / 1

Télécharger la présentation

Understanding Nucleic Acid Binding Domains in Proteins: Structure and Function

An Image/Link below is provided (as is) to download presentation Download Policy: Content on the Website is provided to you AS IS for your information and personal use and may not be sold / licensed / shared on other websites without getting consent from its author. Content is provided to you AS IS for your information and personal use only. Download presentation by click this link. While downloading, if for some reason you are not able to download a presentation, the publisher may have deleted the file from their server. During download, if you can't get a presentation, the file might be deleted by the publisher.

E N D

Presentation Transcript


  1. a. ORF II 88 110 SEA AGSNTQGQYKAPPKKGIKRKYPA SA ......................G Nucleic acid binding domain b. ORF III (i) Cys motif 1 (CP) CXCX2CX4HX4C Lysine-rich core SAKKRKILKRVTNYNKNRRKNYVRRPSIKKKCRCYICQDENHLANRC Wb/Ap/Pb ....T........R.K......K.N..R................. Kk ....TP.......R.K....A.K.N..R................. (ii) Cys motif 2 (region between CP and PR) CX2CX11CX2CX4CX2C PhCEICSYFTDYNKTVSCKTCETQYCKTC Ch/Se .................I......... SA .D..D.Y..F.KT.V.....I...T.. (iii) CP regon interacting with ORF II 739 732 SEAFCRSIYTIA SA ......... (iv) RT active site Ph/Ch SA/Se SFGDLKFALLYIDDILIASNNEK ...................S..Q c. ORF IV Ph Ch Se Wb/Kk Ap Pb LKDQVSLLQKQNSELRARIATNKEIIEGL ......T...................... .RE...H.KNTVETQKQQLREMRDKL... .RE...H.KNTVETQKQQLREMRDKL... .RE...H.KNTIETQKQQ.REMRDK.... Ph/Ch Se Wb/Kk Ap Pb Imperfect Leucine zipper Supplementary Fig. 3

More Related