Download
fisiologi pasca panen n.
Skip this Video
Loading SlideShow in 5 Seconds..
Fisiologi Pasca Panen PowerPoint Presentation
Download Presentation
Fisiologi Pasca Panen

Fisiologi Pasca Panen

1159 Views Download Presentation
Download Presentation

Fisiologi Pasca Panen

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Fisiologi Pasca Panen

  2. Pendahuluan • Beberapa ciri yang membedakan antara bahan baku agroindustri dengan bahan baku industri lain antara lain : • bahan baku agroindustri bersifat musiman, • bulky/voluminous/menghabiskan banyak tempat, • sangat dipengaruhi oleh keadaan perpolitikan dan pemerintahan, • serta bersifat mudah rusak atau perishable.

  3. Salah satu hal yang menyebabkan bahan hasil pertanian mudah rusak adalah karena adanya proses fisiologis lanjutan. • Setelah dipanen, bahan pertanian dapat dikatakan masih “hidup”, karena masih melakukan beberapa metabolisme dalam bahan tersebut. Sebut saja proses respirasi lanjutan dan transpirasi. • Proses metabolisme tersebut yang kemudian dapat menyebabkan bahan hasil pertanian mudah rusak dan tidak dapat bertahan dalam jangka waktu yang lama

  4. PERUBAHAN FISIOLOGIS PASCAPANEN • Padaumumnyatahap-tahapprosespertumbuhanataukehidupanmeliputipembelahansel, pembesaransel, pendewasaansel (maturation), pematangan (ripening), kelayuan (senescence) danpembusukan (deterioration). • Prosespembelahanselberlangsungsegerasetelahterjadinyapembuahankemudiandiikutidenganpembesaranataupengembanganselsampaimencapai volume maksimum.

  5. a. Pematangan. • Pematangandiartikansebagaiperwujudandarimulainyaproseskelayuandimanaorganisasiantarselmenjaditerganggu. Gangguaninimerupakanpelopordarikegiatanhidrolisasubstratolehcampuranenzim-enzim yang adadidalamnya. • Selamaproseshidrolisaterjadipemecahankhlorofil, pati, pectin dan tannin. Dan hasilpemecahansenyawa-senyawatersebutakanterbentukbahan-bahansepertietilen, pigmen, flavor, energidanpolipeptida.

  6. Pematangandapat pula diartikansebagaisuatufaseakhirprosespenguraiansubstratdanmerupakansuatuproses yang dibutuhkanolehbahanuntukmensistesisenzim-enzim yang spesifik yang diantaranyaakandigunakandalamproseskelayuan.

  7. Selamaprosespematanganterjadiperubahan-perubahanwarnadarihijaumenjadikuningataumerah, rasa dariasammenjadimanis, teksturmenjadilebihlunak, terbentuknya vitamin-vitamin, dantimbulnya aroma yang khaskarenaterbentuknyasenyawa-senyawa volatile.

  8. Perubahan-perubahanbuahselamapematangandapatdilihatdalamhalwarna, kekerasan (tekstur), citarasadan flavor, yang menyebabkanterjadinyaperubahankomposisikimiabahan. • Berubahnyawarnadapatdisebabkanoleh 2 faktoryaituprosesdegradasimaupunprosessintesisdaripigmen yang terdapatdalambuah.

  9. Pelunakanbuahdapatdisebabkanolehterjadinyapemecahanprotopektinmenjadi pectin, maupunkarenaterjadinyahidrolisispatiataulemak, danmungkinjuga lignin. • Pematanganakanmenyebabkannaiknyakadargulasederhanauntukmemberikan rasa manis, penurunankadarasam organic dansenyawafenolikuntukmengurangi rasa asamdansepatsertakenaikanproduksizat volatile untukmemberikan flavor karakteristikbuah.

  10. Tekananturgorselselaluberubahselamaprosesperkembangandanpematangan. Perubahaniniumumnyadisebabkankarenakomposisidindingselberubah. Adanyaperubahaninimempengaruhikekerasanbuah, bilabuahmatang.

  11. Kelayuan (Senescence) • Kelayuanadalahsuatutahap normal yang selaluterjadidalamsikluskehidupantanaman. • Dapatpula diartikansebagaisuatutahapkelayuanbuah –buahan yang terjadisetelahprosespematangan, akantetapikelayuan (senescence) dapat pula terjaditanpamelaluitahappematangan, yaitubilaterjadisuatukerusakanpadabuah-buahantersebut.

  12. “Senescence” merupakanhasilperubahan-perubahan yang terjadidalamsel, dindingmenjadilebihtipis, degradasimitokondria, khlorofilmenghilang, kandungan protein menurun, kegiatanpernafasandanfotosintesamenurundansifatpermeabilitasmembranseljugaberubah.

  13. Gejala-gejalakelayuanpadatanamanditandaidenganmenguningnyadaun, perontokandaun, buah, danbagianbunga, pematanganbuah, sertapengurangandayatahanterhadappenyakit. Beberapahormon yang berperanmempengaruhiproses senescence adalahauksin, etilen, giberellin, asamabsisatdansitokinin.

  14. Auksinberperanandalamsintesaetilen, makintinggiauksinmakajumlahetilenyang disintesamakinbanyak. Secaralangsungauksindapatmenghambatterjadinya senescence, hilangnyaauksindapatmenyebabkanterjadinya senescence. • Hormongiberellin yang bekerjasecaraspesifikpadatanamanyaitudapatmenghambatterjadinyapematangan, yang berartidapatmenghambatterjadinya senescence.

  15. Pemberianasamabsisatmempercepatprosespenuaanpadabuah-buahan yang telahdipetikdaritanamannya, namunperanannyadalam senescence belumdiketahuisecarapasti. Hormonsitokinindapatmenghambatterjadinya senescence. Banyaktanaman yang pekaterhadaphormonsitokinin, sedangkanhormonetilendapatmempercepatproses senescence

  16. RESPIRASI • Padawaktumasihberadaditanaman, buah-buahanmelangsungkanproseskehidupannyadengancaramelakukanpernafasan (respirasi), ternyatasetelahdipanenbuah-buahanjugamasihmelangsungkanprosesrespirasi. • Respirasiadalahprosesbiologisdimanaoksigendiserapuntukdigunakanpadaprosespembakaran yang menghasilkanenergidandiikutipengeluaransisapembakarandalambentuk CO2 dan air, sebagaicontohadalahsebagaiberikut: C6H12O6 + 6 O2 CO2 + 6 H2O + Energi

  17. Apabilapersediaanoksigenberkurangmakabuah-buahancenderunguntukmelakukanfermentasiuntukmemenuhikebutuhanenersinya. • Senyawaorganic yang biasadigunakandalamprosesfermentasipadaumumnyaadalahglukosa yang menghasilkanbeberapabahan lain sepertialdehida, alcohol, danasam.

  18. Bilabuahmelakukanfermentasi, makaenergi yang diperolehlebihsedikit per satuansubstratdibandingkandengancarapernafasan (respirasi). Olehkarenaitubilabuahmelakukanfermentasiuntukmemenuhikebutuhanenerginya, diperlukansubstrat (glukosa) lebihbanyaksehinggadalamwaktu yang singkatpersediaansustratakanhabisdanakhirnyabuahtersebutakanmatiataubusuk.

  19. Faktor-faktor yang mempengaruhirespirasidapatdisebabkanatasdua : • Factor internal (daridalambahan) sepertitingkatperkembangan organ; komposisikimiajaringan; ukuranproduk; adanyapelapisanalamipadapermukaankulitnyadanjenisjaringan • Factor eksternal (dariluarlingkungandisekelilingbahan) sepertisuhu; penggunaanetilen; ketersediaanoksigen; karbondioksida; terdapatnyasenyawapengaturpertumbuhan; danadanyalukapadabuah.

  20. KECEPATAN RESPIRASI • Kecepatanrespirasisangatberpengaruhterhadapkecepatanperubahanbeberapaaktivitasdansenyawakimia yang adapadajaringansayurdanbuah, makahaltersebutjugaberpengaruhterhadapdayasimpanbuahdansayurselamapenangananpascapanen. • Semakintinggipanasrespirasi yang dinyatakandalam (Btu/ton/24jam) semakincepatproduksayurdanbuahmengalamipematangandanpembusukan.

  21. KecepatanRespirasiBeberapaJenisSayurdanBuahpadaBerbagaiSuhuPenyimpananKecepatanRespirasiBeberapaJenisSayurdanBuahpadaBerbagaiSuhuPenyimpanan

  22. Pengaruhsuhusangattinggiterhadapkecepatanrespirasi, semakintinggisuhupenyimpanansemakintinggikecepatanrespirasi. Olehsebabitupadapenyimpanansuhurendahakanmenyebabkankecepatanrespirasisemakinrendahdankecepatanpematanganjugarendah. Hal tersebutakanmenyebabkan lama simpanbuahpascanenakansemakinlama • Lajurespirasiseringdigunakansebagaiindeksmasasimpan, yaitu yang lajurespirasinyatinggimasasimpannyapendek, sebaliknya yang lajurespirasinyarendahmaka lama simpannyasemakintinggi.

  23. PanasRespirasiSayurdanBuahpadaBerbagaiSuhuPenyimpanan (Btu/ton/24 jam)

  24. A. Klimakterik • Klimakterikdidefinisikansebagaisuatufase yang kritisdalamkehidupanbuah, danselamanyaterjadinyaprosesinibanyaksekaliperubahan yang berlangsung. • Disampingitujugadapatdiartikansebagaisuatukeadaan “autosimulation” daridalambuahsehinggabuahmenjadimatang yang disertaidenganadanyapeningkatanprosesrespirasi. • Selainituklimakterikdapatdiartikansebagaisuatumasaperalihanprosespertumbuhanmenjadilayu.

  25. Dari semuapengertiantersebutdapatdisimpulkanbahwaklimakterikadalahsuatuperiodemendadak yang unikbagibuah-buahantertentudimanaselamaprosesituterjadiserangkaianperubahanbiologis yang diawalidenganprosespembuatanetilen. Prosesiniditandaidenganmulainyaprosespematangan. • Contoh buah klimaterik : mangga, pisang, apel

  26. B. Non-klimakterik • Non-klimakterikdidefinisikansebagaikelompokbuah-buahan yang selamaprosespematangantidakterjadilonjakandrastiskecepatanrespirasi, sehinggakarenatidakterjadipercepatankecepatanrespirasimakamemungkinkandayasimpanproduklebih lama. Buah-buahan yang tidakpernahmengalamiperiodetersebutdigolongkankedalamgolongan non klimakteriksepertisemangka; jeruk; nanas; dananggur.

  27. PerananEtilenPadaProsesPematanganBuah-Buahan • Etilenmerupakansenyawahidrokarbontidakjenuhpadasuhuruangberbentuk gas, dapatdihasilkanolehjaringantanamanhiduppadawaktutertentu. Etilendapatmenyebabkanterjadinyaperubahan-perubahan yang pentingdalamprosespertumbuhandanpematanganhasilpertanian. • Etilendalamkehidupantanamandapatdigolongkansebagaihormon yang aktifdalamprosespematangan. Disebuthormonkarenadapatmemenuhi criteria sebagaihormontanaman, bersifatmobil (mudahbergerak) dalamjaringantanamandanmerupakansenyawa organic.

  28. Etilendisampingdapatmemulaiprosesklimakterik, jugadapatmempercepatterjadinyaklimakterik • Misalnyapadabuah alpukad yang disimpandalamudarabiasaakanmatangsetelah 11 hari, tetapiapabiladisimpanpadaudara yang mengandungetilen 10 ppmetilenselama 24 jam, makabuah alpukadakanmatangselama 6 haripenyimpanan. • Padabuah-buahan non klimakterik, penambahanetilendalamkonsentrasitinggiakanmenyebabkanterjadinyaklimakterikpadabuahtersebut, sepertipadajeruk.

  29. TEKNOLOGI PENANGANAN PROSES A. Prapendinginan • Istilahtersebutberasaldariprecooling yang dapatdiartikansebagaipemindahanpanasrespirasiataupanaslapangandarisekitarbuah-buahandansayur-sayuransegarselamapemasaranatausebelumpengolahanlanjutan. Adabeberapametodeprecooling , diantaranyaadalah : 1).Hidrocooling 2). Vacuum cooling 3). Pendinginandenganes 4). Precoolingdenganudaradingin • Pemilihanmetodependinginantersebuttergantungdaribeberapapertimbangan, diantaranyameliputi : perishabilitydariproduct; kebutuhanprodukakansuhurendahdanfasilitas yang dimiliki.

  30. B. Penurunan Kadar air • Teknologiinibanyakdigunakanpadaprodukbiji-bijian (gabah, jagung, kedelai, dangandum). Selainproduktersebutdapatjugadilakukanterhadapprodukubi-ubiandan lain-lain. Prinsipkerjadaripengeringanbertujuanuntukmengurangiaktivitaskecepatanenzimdalamjaringansayurdanbuahmelauipenurunanketersediaan air (Aw) bagiaktivitasenzim.

  31. Terima kasih