Download
weaver et al supplemental figure 1 n.
Skip this Video
Loading SlideShow in 5 Seconds..
Weaver et al. supplemental Figure 1 PowerPoint Presentation
Download Presentation
Weaver et al. supplemental Figure 1

Weaver et al. supplemental Figure 1

67 Vues Download Presentation
Télécharger la présentation

Weaver et al. supplemental Figure 1

- - - - - - - - - - - - - - - - - - - - - - - - - - - E N D - - - - - - - - - - - - - - - - - - - - - - - - - - -
Presentation Transcript

  1. Weaver et al. supplemental Figure 1 A BALB/c Epitope Immunogen Peptide B1 B2 B3 B4 B5 B6 B7 B8 B9 B10 B11 B12 UG37(A) KVTFEPIPIHYCAPA (53) STVQCTHGIRPVVST (62) RIKQIINMWQRVGQA (104) GIVQQQSNLLRAIEAQQHLLKLTVWGIKQLQ(136,137,138,140) RVLAVERYLRDQQLL(144) LYKYKVVKIEPLGVA(120) SF162(B) CPKVSFEPIPIHYCAPAGF (7459,7460) VQCTHGIRPVVSTQL (7469) VQQQNNLLRAIEAQQ LLQLTVWGIKQLQAR(7544,7548) 92RW020_A Chn19(C)P QQSNLLRAIEAQQHLLQLTVWGIKQLQTRV(4884,4885) UG37(A) DTEVHNVWATHACVP(16) KVTFEPIPIHYCAPA(53) STVQCTHGIRPVVST(62) SF162(B) VQCTHGIRPVVSTQL (7469) CPKVSFEPIPIHYCA(7459) KSIPIGPGKAFYATGDIIG(7484,7485) JRFL_B DTEVHNVWATHACVP(7423) Chn19(C)P GKEVHNVWATHACVPTDPNP(4836) UG37(A) DTEVHNVWATHACVP(16) GIVQQQSNLLRAIEAQQHLL(136,137) SF162(B) 96ZM651_C DTEVHNVWATHACVP(7423) VQQQNNLLRAIEAQQ(7544) Chn19(C)P VPVWKEAKTTLFCASDAKAYGKEVHNVWATHACVPTDPNP SSENSSEYYRLINCNTSAIT(4848) QQSNLLRAIEAQQHLLQLTV (4884) (4834) (4836) UG37(A) KVTFEPIPIHYCAPA (53) DTEVHNVWATHACVP(16) RIKQIINMWQRVGQA(104) LYKYKVVKIEPLGVA(120) GIVQQQSNLLRAIEAQQHL(136,137) RVLAVERYLRDQQLL(144) 92RW020_A SF162(B) JRFL_B CPKVSFEPIPIHYCAPAGF(7459,7460) VQCTHGIRPVVSTQL(7469) VQQQNNLLRAIEAQQ(7544) Chn19(C)P VPVWKEAKTTLFCASDAKAYGKEVHNVWATHACVPTDPNP QQSNLLRAIEAQQHLLQLTVWGIKQLQTRV(4884,4885) 96ZM651_C (4834) (4836) (136,137,138,140) UG37(A) LYKYKVVKIEPLGVA(120) QLQARVLAVERYLRDQQLL(143,144) DTEVHNVWATHACVP(16) KVTFEPIPIHYCAPA(53) GIVQQQSNLLRAIEAQQHLLKLTVWGIKQLQ CON6 SF162(B) DTEVHNVWATHACVP(7423) CPKVSFEPIPIHYCAPAGF(7459,7460) VQQQNNLLRAIEAQQ(7544) Chn19(C)P SSENSSEYYRLINCNTSAIT(4848) QQSNLLRAIEAQQHLLQLTVWGIKQLQTRV(4884,4885) GKEVHNVWATHACVPTDPNP STVQCTHGIKPVVSTQLLLN(4854) (4836) B C57BL/6 Immunogen Peptide C1 C2 C3 C4 C5 C6 C7 C8 C9 UG37(A) QARPKVTFEPIPIHYCAPA(52,53) GDIIGDIRQAHCNVS(81) SF162(B) IIGDIRQAHCNISGE(7488) ITQACPKVSFEPIPIHYCAPAGFAILK(7458,7459,7460,7461) 92RW020_A Deleted Chn19(C)P SSENSSEYYRLINCNTSAIT(4848) GDIRQAHCNISKDKWNETLQ(4862) UG37(A) DTEVHNVWATHACVP(16) QARPKVTFEPIPIHYCAPA(52,53) ICPTNVPWNSSWSNKSLDE(150,151) TIKIYELIEESQIQQ(159) SF162(B) JRFL_B DTEVHNVWATHACVP(7423) CPKVSFEPIPIHYCAPAGFAILK(7459,7460,7461) IIGDIRQAHCNISGE(7488) CTTAVPWNASWSNKSLDQI(7558,7559) Chn19(C)P GKEVHNVWATHACVPTDPNP(4836) GDIRQAHCNISKDKWNETLQ(4862) KLICTTTVPWNTSWSNKSLD(4889) UG37(A) DTEVHNVWATHACVP(16) EPIPIHYCAPAGYAI(54) SF162(B) DTEVHNVWATHACVP(7423) ITQACPKVSFEPIPIHYCAPAGFAILK(7458,7461) 96ZM651_C IIGDIRQAHCNISGE(7488) Chn19(C)P IPIHYCTPAGYAILKCNDKT(4851) GKEVHNVWATHACVPTDPNP(4836) SSENSSEYYRLINCNTSAIT(4848) GDIRQAHCNISKDKWNETLQ(4862) UG37(A) 92RW020_A DTEVHNVWATHACVP(16) QARPKVTFEPIPIHYCAPA(52,53) ICPTNVPWNSSWSNKSLDE(150,151) TIKIYELIEESQIQQ(159) JRFL_B SF162(B) DTEVHNVWATHACVP(7423) PKVSFEPIPIHYCAPAGFAILK(7459,7460,7461) CTTAVPWNASWSNKSLDQI(7558,7559) IIGDIRQAHCNISGE(7488) 96ZM651_C Chn19(C)P GKEVHNVWATHACVPTDPNP(4836) GDIRQAHCNISKDKWNETLQ(4862) KLICTTTVPWNTSWSNKSLD(4889) UG37(A) QARPKVTFEPIPIHYCAPA(52,53) DTEVHNVWATHACVP(16) GDIIGDIRQAHCNVSGSQW(81,82) CNTSGLFNSTWVNGT(97) ICPTNVPWNSSWSNKSLDE(150,151) TIKIYELIEESQIQQ(159) CON6 SF162(B) DTEVHNVWATHACVP(7423) IIGDIRQAHCNISGE(7488) CTTAVPWNASWSNKSLDQI(7558,7559) ITQACPKVSFEPIPIHYCAPAGFAILK(7458,7459,7460,7461) Chn19(C)P MRVTGIRKNYQHLWRWGTMLLGML(4830, 5445) GKEVHNVWATHACVPTDPNP(4836) GDIRQAHCNISKDKWNETLQ(4862) LLGIWGCSGKLICTTTVPWNTSWSNKSLD(4888,4889) C C3H-NeJ Immunogen Peptide H1 H2 H3 H4 H5 H6 H7 UG37(A) TDIISLWDQSLKPCV(27) QHLLKLTVWGIKQLQARVLAVERYLRD(140,141,143) LLQLTVWGIKQLQARVLAVERYLKDQ(7548,7549,7551) SF162(B) 92RW020_A Chn19(C)P NQMHEDVISLWDQSLKPCVK(4840) AQQHLLQLTVWGIKQLQTRVLAIERYLKDQ(4885,4886) UG37(A) TDIISLWDQSLKPCV(27) QHLLKLTVWGIKQLQARVL(140,141) NNLLRAIEAQQHLLQLTVWGIKQLQARVLAV(7545,7548,7549) SF162(B) VLENVTENFNMWKNNMVEQ(7429,7430) JRFL_B Chn19(C)P QEMVLENVTENFNMWKNDMVNQMHEDVISLWDQSLKPCVK(4838,4840) AQQHLLQLTVWGIKQLQTRVLAIERYLKDQ(4885,4886) WEREIDNYTSLIYTLLEESQ(4892) UG37(A) TDIISLWDQSLKPCV(27) QHLLKLTVWGIKQLQARVLAVERYLRD(140,141,143) SF162(B) VLENVTENFNMWKNNMVEQ(7429,7430) LLQLTVWGIKQLQARVLAVERYLKDQ(7548,7549,7551) 96ZM651_C Chn19(C)P QEMVLENVTENFNMWKNDMVNQMHEDVISLWDQSLKPCVK(4838,4840) AQQHLLQLTVWGIKQLQTRVLAIERYLKDQ(4885,4886) UG37(A) TDIISLWDQSLKPCV(27) QHLLKLTVWGIKQLQARVLAVERYLRD(140,141,143) 92RW020_A JRFL_B VLENVTENFNMWKNNMVEQ(7429,7430) SF162(B) NNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLKDQ(7545,7548,7549,7551) QEMVLENVTENFNMWKNDMVNQMHEDVISLWDQSLKPCVK(4838,4840) 96ZM651_C Chn19(C)P AQQHLLQLTVWGIKQLQTRVLAIERYLKDQ(4885,4886) WEREIDNYTSLIYTLLEESQ(4892) UG37(A) TDIISLWDQSLKPCV(27) QHLLKLTVWGIKQLQARVLAVERYLRD(140,141,143) CON6 SLTLTVQARQLLSGI(7540) SF162(B) VLENVTENFNMWKNNMVEQ(7429,7430) LLQLTVWGIKQLQARVLAVERYLKDQ(7548,7549,7551) Chn19(C)P QEMVLENVTENFNMWKNDMVNQMHEDVISLWDQSLKPCVK(4838,4840) GAASITLTVQARQLLSGIVQ(4882) AQQHLLQLTVWGIKQLQTRVLAIERYLKDQ(4885,4886)

  2. Weaver et al. supplemental Figure 2 A BALB/c Epitope Immunogen Peptide B1 B2 B4 B5 B6 B7 B9 B11 MN TVQCTHGIRPVVSTQ (6271) ACPKISFEPIPIHYC (6261) IVQQQNNLLRAIEAQ(6346) LTVWGIKQLQARVLA(6351) 89.6 VSFQPIPIHYCVPAGFAILK PCTNVSTVQCTHGIRPVVST (4721,4724) ITLQCRIKQIINMWQKVGKA(4741) LLLSGIVQQQNNLLRAIEAQQNMLQLTVWGIKQLQARVLA(4754,4756) 92RW020_A SF162 CPKVSFEPIPIHYCAPAGF (7459,7460) VQCTHGIRPVVSTQL (7469) VQQQNNLLRAIEAQQ LLQLTVWGIKQLQAR(7544,7548) MN TVQCTHGIRPVVSTQ(6271) RKRIHIGPGRAFYTT(6286) VPVWKEATTTLFCAS(6219) 89.6 JRFL_B PCTNVSTVQCTHGIRPVVST(4724) GVPVWREATTTLFCASDAKAYDTEVHNVWATHACVPTDPN(4704,4706) RPNNNTRRRLSIGPGRAFYARRNIIGDIRQ(4730,4731) SF162 VQCTHGIRPVVSTQL (7469) CPKVSFEPIPIHYCA(7459) KSIPIGPGKAFYATGDIIG(7484,7485) DTEVHNVWATHACVP(7423) MN IVQQQNNLLRAIEAQ(6346) 89.6 96ZM651_C LLLSGIVQQQNNLLRAIEAQ(4754) YDTEVHNVWATHACVPTDPN(4706) SF162 DTEVHNVWATHACVP(7423) VQQQNNLLRAIEAQQ(7544) MN IVQQQNNLLRAIEAQ(6346) 92RW020_A RKRIHIGPGRAFYTT(6286) ACPKISFEPIPIHYC(6261) TVQCTHGIRPVVSTQ(6271) 89.6 JRFL_B YDTEVHNVWATHACVPTDPN(4706) LLLSGIVQQQNNLLRAIEAQ(4754) PCTNVSTVQCTHGIRPVVST(4724) RPNNNTRRRLSIGPGRAFYARRNIIGDIRQ(4730,4731) SF162 CPKVSFEPIPIHYCAPAGF(7459,7460) VQCTHGIRPVVSTQL(7469) VQQQNNLLRAIEAQQ(7544) 96ZM651_C MN DTEVHNVWATQACVP(6224) IVQQQNNLLRAIEAQ(6346) 89.6 CON6 LLLSGIVQQQNNLLRAIEAQQNMLQLTVWGIKQLQARVLA(4754,4756) VSFQPIPIHYCVPAGFAILK(4721) YDTEVHNVWATHACVPTDPN(4706) SF162 DTEVHNVWATHACVP(7423) CPKVSFEPIPIHYCAPAGF(7459,7460) VQQQNNLLRAIEAQQ(7544) B C57BL/6 Immunogen Peptide C4 C5 C2 C6 C7 C8 MN ISFEPIPIHYCAPAGFAILKCND(6262,6263,6264) NIIGTIRQAHCNISRAKWN(6290) Deleted 89.6 TSVITQACPKVSFQPIPIHYCVPAGFAILK(4720,4721) RRNIIGDIRQAHCNISRAKW(4732) 92RW020_A SF162 IIGDIRQAHCNISGE(7488) ITQACPKVSFEPIPIHYCAPAGFAILK(7458,7459,7460,7461) DTEVHNVWATQACVP(6224) MN ISFEPIPIHYCAPAGFAILKCND(6262,6263,6264) NIIGTIRQAHCNISR(6290) CTTTVPWNASWSNKS(6360) 89.6 JRFL_B YDTEVHNVWATHACVPTDPN(4706) RRNIIGDIRQAHCNISRAKW(4732) ICTTSVPWNVSWSNKSVDDI(4760) VSFQPIPIHYCVPAGFAILK(4721) SF162 DTEVHNVWATHACVP(7423) CPKVSFEPIPIHYCAPAGFAILK(7459,7460,7461) IIGDIRQAHCNISGE(7488) CTTAVPWNASWSNKSLDQI(7558,7559) MN PIPIHYCAPAGFAIL(6263) NIIGTIRQAHCNISRAKWN(6290) YDTEVHNVWATHACVPTDPN(4706) 89.6 RRNIIGDIRQAHCNISRAKW(4732) TSVITQACPKVSFQPIPIHY(4720) 96ZM651_C ITQACPKVSFEPIPIHYCAPAGFAILK(7458,7461) SF162 DTEVHNVWATHACVP(7423) IIGDIRQAHCNISGE(7488) MN 92RW020_A ISFEPIPIHYCAPAGFAIL(6262,6263) NIIGTIRQAHCNISRAKWN(6290,6291) CTTTVPWNASWSNKS(6360) JRFL_B 89.6 YDTEVHNVWATHACVPTDPN(4706) RRNIIGDIRQAHCNISRAKW(4732) ICTTSVPWNVSWSNKSVDDI(4760) SF162 96ZM651_C DTEVHNVWATHACVP(7423) ITQACPKVSFEPIPIHYCAPAGFAILK(7459,7460,7461) CTTAVPWNASWSNKSLDQI(7558,7559) IIGDIRQAHCNISGE(7488) MN DTEVHNVWATQACVP(6224) ISFEPIPIHYCAPAGFAILKCND(6262,6263,6264) NIIGTIRQAHCNISR(6290) CTTTVPWNASWSNKS(6360) 89.6 CON6 YDTEVHNVWATHACVPTDPN(4706) RRNIIGDIRQAHCNISRAKW(4732) GEFFYCNTAQLFNSTWNVAG(4738) ICTTSVPWNVSWSNKSVDDI(4760) TSVITQACPKVSFQPIPIHY(4720) SF162 DTEVHNVWATHACVP(7423) IIGDIRQAHCNISGE(7488) CTTAVPWNASWSNKSLDQI(7558,7559) ITQACPKVSFEPIPIHYCAPAGFAILK(7458,7459,7460,7461) C C3H-NeJ Immunogen Peptide H1 H2 H3 H4 H5 H6 H7 MN EDIISLWDQSLKPCV(6235) HMLQLTVWGIKQLQARVLAVERYLKDQQLLG(6350,6351,6353,6354) 89.6 92RW020_A QNMLRLTVWGIKQLQARVLALERYLRDQQL(4756,4757) LLQLTVWGIKQLQARVLAVERYLKDQ(7548,7549,7551) SF162 MN EDIISLWDQSLKPCV(6235) QNNLLRAIEAQQHMLQLTVWGIKQLQARVLAVERYLKDQ(6347,6350,6351,6353) EREIDNYTSLIYSLL(6367) 89.6 PQEVVLGNVTENFNMWKNNM(4708) JRFL_B QNMLRLTVWGIKQLQARVLAL(4756) SF162 VLENVTENFNMWKNNMVEQ(7429,7430) NNLLRAIEAQQHLLQLTVWGIKQLQARVLAV(7545,7548,7549) MN EDIISLWDQSLKPCV(6235) HMLQLTVWGIKQLQARVLAVERYLKDQQLLG(6350,6351,6353,6354) 89.6 PQEVVLGNVTENFNMWKNNM(4708) QNMLRLTVWGIKQLQARVLALERYLRDQQL(4756,4757) 96ZM651_C SF162 VLENVTENFNMWKNNMVEQ(7429,7430) LLQLTVWGIKQLQARVLAVERYLKDQ(7548,7549,7551) MN EDIISLWDQSLKPCV(6235) EREIDNYTSLIYSLL(6367) 92RW020_A QNNLLRAIEAQQHMLQLTVWGIKQLQARVLAVERYLKDQQLLG(6347,6350,6351,6353,6354) QNMLRLTVWGIKQLQARVLALERYLRDQQL(4756,4757) 89.6 PQEVVLGNVTENFNMWKNNM(4708) JRFL_B VLENVTENFNMWKNNMVEQ(7429,7430) SF162 NNLLRAIEAQQHLLQLTVWGIKQLQARVLAVERYLKDQ(7545,7548,7549,7551) 96ZM651_C MN EDIISLWDQSLKPCV(6235) HMLQLTVWGIKQLQARVLAVERYLKDQQLLG(6350,6351,6353,6354) CON6 PQEVVLGNVTENFNMWKNNM(4708) 89.6 QNMLRLTVWGIKQLQARVLALERYLRDQQL(4756,4757) SLTLTVQARQLLSGI(7540) SF162 VLENVTENFNMWKNNMVEQ(7429,7430) LLQLTVWGIKQLQARVLAVERYLKDQ(7548,7549,7551)

  3. Weaver et al. supplemental Table 1